Enhanced Validation

Anti-PLA2R1 Antibody

phospholipase A2 receptor 1, 180kDa
References (12)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human PLA2R1
Alternative Gene Names
CLEC13C, PLA2-R, PLA2G1R, PLA2IR
Open Datasheet
Price
$450.00
Product Number
HPA012657
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemistry analysis in human kidney and pancreas tissues using HPA012657 antibody. Corresponding PLA2R1 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in control (vector only transfected HEK293T lysate) and PLA2R1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY423477).

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
phospholipase A2 receptor 1, 180kDa
Target Gene
PLA2R1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000008129 (76%)

Mouse ENSMUSG00000054580 (74%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA012657 on the Human Protein Atlas
Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
phospholipase A2 receptor 1, 180kDa
Gene Name
PLA2R1
Alternative Gene Names
CLEC13C, PLA2-R, PLA2G1R, PLA2IR
UniProt ID
Q13018
Gene (Ensembl)
ENSG00000153246
Entrez Gene ID
Entrez gene: 22925
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000153246 on the Human Protein Atlas

Zhang Q, Huang B, Liu X, Liu B, Zhang Y, Zhang Z, Hua J, Fan Y, Hu L, Meng M, Wu M, Wang L, Hu Z, Sun Z

Ultrasensitive Quantitation of Anti-Phospholipase A2 Receptor Antibody as A Diagnostic and Prognostic Indicator of Idiopathic Membranous Nephropathy

Sci Rep , 2017 Sep 21; 7:12049. Epub 2017 Sep 21

PubMed ID: 28935926 DOI: 10.1038/s41598-017-12014-1

Wang J, Xie Q, Sun Z, Xu N, Li Y, Wang L, Liu S, Xue J, Hao CM

Response to immunosuppressive therapy in PLA2R- associated and non-PLA2R- associated idiopathic membranous nephropathy: a retrospective, multicenter cohort study

BMC Nephrol , 2017 Jul 10; 18:227. Epub 2017 Jul 10

PubMed ID: 28693446 DOI: 10.1186/s12882-017-0636-0

A Griveau, G Devailly, L Eberst, N Navaratnam, B Le Calvé, M Ferrand, P Faull, A Augert, R Dante, J M Vanacker, D Vindrieux, D Bernard

The PLA2R1-JAK2 pathway upregulates ERRα and its mitochondrial program to exert tumor-suppressive action

Oncogene , April 04, 2016

PubMed ID: None DOI: 10.1038/onc.2016.43

Akiyama S, Akiyama M, Imai E, Ozaki T, Matsuo S, Maruyama S

Prevalence of anti-phospholipase A2 receptor antibodies in Japanese patients with membranous nephropathy

Clin Exp Nephrol , 2015 Aug; 19(4):653-660. Epub 2014 Nov 21

PubMed ID: 25412738 DOI: 10.1007/s10157-014-1054-2

Dauvergne M, Moktefi A, Rabant M, Vigneau C, Kofman T, Burtey S, Corpechot C, Stehlé T, Desvaux D, Rioux-Leclercq N, Rouvier P, Knebelmann B, Boffa JJ, Frouget T, Daugas E, Jablonski M, Dahan K, Brocheriou I, Remy P, Grimbert P, Lang P, Chazouilleres O, Sahali D, Audard V

Membranous Nephropathy Associated With Immunological Disorder-Related Liver Disease: A Retrospective Study of 10 Cases

Medicine (Baltimore) , 2015 Jul; 94(30):e1243. Epub 2015 Jul 31

PubMed ID: 26222864 DOI: 10.1097/MD.0000000000001243

Iwakura T, Ohashi N, Kato A, Baba S, Yasuda H

Prevalence of Enhanced Granular Expression of Thrombospondin Type-1 Domain-Containing 7A in the Glomeruli of Japanese Patients with Idiopathic Membranous Nephropathy

PLoS One , 2015; 10(9):e0138841. Epub 2015 Sep 22

PubMed ID: 26393352 DOI: 10.1371/journal.pone.0138841

Augert A, Vindrieux D, Girard CA, Le Calvé B, Gras B, Ferrand M, Bouchet BP, Puisieux A, de Launoit Y, Simonnet H, Lambeau G, Bernard D

PLA2R1 kills cancer cells by inducing mitochondrial stress.

Free Radic Biol Med , 2013 Dec; 65:969-77. Epub 2013 Aug 29

PubMed ID: 23994771 DOI: 10.1016/j.freeradbiomed.2013.08.177

Svobodova B, Honsova E, Ronco P, Tesar V, Debiec H

Kidney biopsy is a sensitive tool for retrospective diagnosis of PLA2R-related membranous nephropathy.

Nephrol Dial Transplant , 2013 Jul; 28(7):1839-44. Epub 2012 Dec 6

PubMed ID: 23223223 DOI: 10.1093/ndt/gfs439

Hoxha E, Kneißler U, Stege G, Zahner G, Thiele I, Panzer U, Harendza S, Helmchen UM, Stahl RA

Enhanced expression of the M-type phospholipase A2 receptor in glomeruli correlates with serum receptor antibodies in primary membranous nephropathy.

Kidney Int , 2012 Oct; 82(7):797-804. Epub 2012 Jun 6

PubMed ID: 22673885 DOI: 10.1038/ki.2012.209

Debiec H, Martin L, Jouanneau C, Dautin G, Mesnard L, Rondeau E, Mousson C, Ronco P

Autoantibodies specific for the phospholipase A2 receptor in recurrent and De Novo membranous nephropathy.

Am J Transplant , 2011 Oct; 11(10):2144-52. Epub 2011 Aug 9

PubMed ID: 21827616 DOI: 10.1111/j.1600-6143.2011.03643.x

Debiec H, Ronco P

PLA2R autoantibodies and PLA2R glomerular deposits in membranous nephropathy.

N Engl J Med , 2011 Feb 17; 364(7):689-90

PubMed ID: 21323563 DOI: 10.1056/NEJMc1011678

Did we miss your publication?

Have you published using HPA012657? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-PLA2R1 (AMAb90772)
Anti-PLA2R1 (AMAb90775)
Corresponding Antigens
PrEST Antigen PLA2R1 (APrEST72110)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch