Enhanced Validation

Polyclonal Anti-PKM Antibody

pyruvate kinase, muscle
References (4)
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human PKM
Alternative Gene Names
OIP3, PK3, PKM2, THBP1
Open Datasheet
Price
$505.00
Product Number
HPA029501
Unit Size
100 µl
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Show all images
[4 pictures]
Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Show all images
[2 pictures]
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PKM antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
pyruvate kinase, muscle
Target Gene
PKM
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSL
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000032294 (98%)

Rat ENSRNOG00000011329 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA029501 on the Human Protein Atlas
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA029501 on the Human Protein Atlas
Protein Name
pyruvate kinase, muscle
Gene Name
PKM
Alternative Gene Names
OIP3, PK3, PKM2, THBP1
UniProt ID
P14618
Gene (Ensembl)
ENSG00000067225
Entrez Gene ID
Entrez gene: 5315
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000067225 on the Human Protein Atlas

Ludvigsen M, Thorlacius-Ussing L, Vorum H, Stender MT, Thorlacius-Ussing O, Honoré B

Proteomic Characterization of Colorectal Cancer Tissue from Patients Identifies Novel Putative Protein Biomarkers

Curr Issues Mol Biol , 2021 Sep 2; 43(2):1043-1056. Epub 2021 Sep 2

PubMed ID: 34563043 DOI: 10.3390/cimb43020074

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

Röwer C, Ziems B, Radtke A, Schmitt O, Reimer T, Koy C, Thiesen HJ, Gerber B, Glocker MO

Toponostics of invasive ductal breast carcinoma: combination of spatial protein expression imaging and quantitative proteome signature analysis

Int J Clin Exp Pathol , 2011 Mar 31; 4(5):454-467. Epub 2011 Feb 28

PubMed ID: 21738817

Did we miss your publication?

Have you published using HPA029501? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen PKM (APrEST73808)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch