Enhanced Validation

Anti-PHGDH Antibody

phosphoglycerate dehydrogenase
Recommended Applications
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human PHGDH
Alternative Gene Names
PDG, PGDH, SERA
Price
$437.00
Product Number
HPA021241
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
phosphoglycerate dehydrogenase
Target gene
PHGDH
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDM
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000019328 (99%)

Mouse ENSMUSG00000053398 (99%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Protein Name
phosphoglycerate dehydrogenase
Gene Name
PHGDH
Alternative Gene Names
PDG, PGDH, SERA
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000092621 on the Human Protein Atlas

Hauser DN, Mamais A, Conti MM, Primiani CT, Kumaran R, Dillman AA, Langston RG, Beilina A, Garcia JH, Diaz-Ruiz A, Bernier M, Fiesel FC, Hou X, Springer W, Li Y, de Cabo R, Cookson MR

Hexokinases link DJ-1 to the PINK1/parkin pathway

Mol Neurodegener , 2017 Sep 29; 12:70. Epub 2017 Sep 29

PubMed ID: 28962651 DOI: 10.1186/s13024-017-0212-x

Yoshino H, Nohata N, Miyamoto K, Yonemori M, Sakaguchi T, Sugita S, Itesako T, Kofuji S, Nakagawa M, Dahiya R, Enokida H

PHGDH as a key enzyme for serine biosynthesis in HIF2α-targeting therapy for renal cell carcinoma

Cancer Res , 2017 Sep 26; 77(22):6321-6329. Epub 2017 Sep 26

PubMed ID: 28951458 DOI: 10.1158/0008-5472.CAN-17-1589

Oliver D. K. Maddocks, Dimitris Athineos, Eric C. Cheung, Pearl Lee, Tong Zhang, Niels J. F. van den Broek, Gillian M. Mackay, Christiaan F. Labuschagne, David Gay, Flore Kruiswijk, Julianna Blagih, David F. Vincent, Kirsteen J. Campbell, Fatih Ceteci, Owen J. Sansom, Karen Blyth, Karen H. Vousden

Modulating the therapeutic response of tumours to dietary serine and glycine starvation

Nature , 544, 372-376 (2017)

DOI: 10.1038/nature22056

Unterlass JE, Baslé A, Blackburn TJ, Tucker J, Cano C, Noble ME, Curtin NJ

Validating and enabling phosphoglycerate dehydrogenase (PHGDH) as a target for fragment-based drug discovery in PHGDH-amplified breast cancer

Oncotarget , 2016 Aug 22; 9(17):13139-13153. Epub 2016 Aug 22

PubMed ID: 29568346 DOI: 10.18632/oncotarget.11487

Brown DM, Williams H, Ryan KJ, Wilson TL, Daniel ZC, Mareko MH, Emes RD, Harris DW, Jones S, Wattis JA, Dryden IL, Hodgman TC, Brameld JM, Parr T

Mitochondrial phosphoenolpyruvate carboxykinase (PEPCK-M) and serine biosynthetic pathway genes are co-ordinately increased during anabolic agent-induced skeletal muscle growth

Sci Rep , 2016 Jun 28; 6:28693. Epub 2016 Jun 28

PubMed ID: 27350173 DOI: 10.1038/srep28693

Michael E Pacold, Kyle R Brimacombe, Sze Ham Chan, Jason M Rohde, Caroline A Lewis, Lotteke J Y M Swier, Richard Possemato, Walter W Chen, Lucas B Sullivan, Brian P Fiske, Steve Cho, Elizaveta Freinkman, Kıvanç Birsoy, Monther Abu-Remaileh, Yoav D Shaul, Chieh Min Liu, Minerva Zhou, Min Jung Koh, Haeyoon Chung, Shawn M Davidson, Alba Luengo, Amy Q Wang, Xin Xu, Adam Yasgar, Li Liu, Ganesha Rai, Kenneth D Westover, Matthew G Vander Heiden, Min Shen, Nathanael S Gray, Matthew B Boxer, David M Sabatini

A PHGDH inhibitor reveals coordination of serine synthesis and one-carbon unit fate

Nature Chemical Biology , April 25, 2016

PubMed ID: 0 DOI: 10.1038/nchembio.2070

Pacold ME, Brimacombe KR, Chan SH, Rohde JM, Lewis CA, Swier LJ, Possemato R, Chen WW, Sullivan LB, Fiske BP, Cho SW, Freinkman E, Birsoy K, Abu-Remaileh M, Shaul YD, Liu CM, Zhou M, Koh MJ, Chung H, Davidson SM, Luengo A, Wang AQ, Xu X, Yasgar A, Liu L, Rai G, Westover KD, Vander Heiden MG, Shen M, Gray NS, Boxer MB, Sabatini DM

A PHGDH inhibitor reveals coordination of serine synthesis and 1-carbon unit fate

Nat Chem Biol , 2016 Apr 25; 12(6):452-458. Epub 2016 Apr 25

PubMed ID: 27110680 DOI: 10.1038/nchembio.2070

Mullarky E, Lucki NC, Beheshti Zavareh R, Anglin JL, Gomes AP, Nicolay BN, Wong JC, Christen S, Takahashi H, Singh PK, Blenis J, Warren JD, Fendt SM, Asara JM, DeNicola GM, Lyssiotis CA, Lairson LL, Cantley LC

Identification of a small molecule inhibitor of 3-phosphoglycerate dehydrogenase to target serine biosynthesis in cancers

Proc Natl Acad Sci U S A , 2016 Feb 1; 113(7):1778-1783. Epub 2016 Feb 1

PubMed ID: 26831078 DOI: 10.1073/pnas.1521548113

Mattaini KR, Brignole EJ, Kini M, Davidson SM, Fiske BP, Drennan CL, Vander Heiden MG

An epitope tag alters phosphoglycerate dehydrogenase structure and impairs ability to support cell proliferation

Cancer Metab , 2015; 3:5. Epub 2015 Apr 29

PubMed ID: 25926973 DOI: 10.1186/s40170-015-0131-7

DeNicola GM, Chen PH, Mullarky E, Sudderth JA, Hu Z, Wu D, Tang H, Xie Y, Asara JM, Huffman KE, Wistuba II, Minna JD, DeBerardinis RJ, Cantley LC

NRF2 regulates serine biosynthesis in non-small cell lung cancer

Nat Genet , 2015/12/01; 47(12):1475-1481. Epub 2015 Oct 19

PubMed ID: 26482881 DOI: 10.1038/ng.3421

Gromova I, Gromov P, Honma N, Kumar S, Rimm D, Talman ML, Wielenga VT, Moreira JM

High level PHGDH expression in breast is predominantly associated with keratin 5‐positive cell lineage independently of malignancy

Mol Oncol , 2015 May 14; 9(8):1636-1654. Epub 2015 May 14

PubMed ID: 26026368 DOI: 10.1016/j.molonc.2015.05.003

Markkanen E, Fischer R, Ledentcova M, Kessler BM, Dianov GL

Cells deficient in base-excision repair reveal cancer hallmarks originating from adjustments to genetic instability

Nucleic Acids Res , 2015 Apr 20; 43(7):3667-3679. Epub 2015 Mar 23

PubMed ID: 25800737 DOI: 10.1093/nar/gkv222

Ou Y, Wang SJ, Jiang L, Zheng B, Gu W

p53 Protein-mediated Regulation of Phosphoglycerate Dehydrogenase (PHGDH) Is Crucial for the Apoptotic Response upon Serine Starvation

J Biol Chem , 2015/01/02; 290(1):457-466. Epub 2014 Nov 17

PubMed ID: 25404730 DOI: 10.1074/jbc.M114.616359

Maddocks OD, Berkers CR, Mason SM, Zheng L, Blyth K, Gottlieb E, Vousden KH

Serine starvation induces stress and p53-dependent metabolic remodelling in cancer cells.

Nature , 2013 Jan 24; 493(7433):542-6. Epub 2012 Dec 16

PubMed ID: 23242140 DOI: 10.1038/nature11743

Nilsson LM, Forshell TZ, Rimpi S, Kreutzer C, Pretsch W, Bornkamm GW, Nilsson JA

Mouse genetics suggests cell-context dependency for Myc-regulated metabolic enzymes during tumorigenesis.

PLoS Genet , 2012; 8(3):e1002573. Epub 2012 Mar 15

PubMed ID: 22438825 DOI: 10.1371/journal.pgen.1002573

Maddocks OD, Berkers CR, Mason SM, Zheng L, Blyth K, Gottlieb E, Vousden KH

Serine starvation induces stress and p53 dependent metabolic remodeling in cancer cells

Nature , 2012 Dec 16; 493(7433):542-546. Epub 2012 Dec 16

PubMed ID: 23242140 DOI: 10.1038/nature11743

Possemato R, Marks KM, Shaul YD, Pacold ME, Kim D, Birsoy K, Sethumadhavan S, Woo HK, Jang HG, Jha AK, Chen WW, Barrett FG, Stransky N, Tsun ZY, Cowley GS, Barretina J, Kalaany NY, Hsu PP, Ottina K, Chan AM, Yuan B, Garraway LA, Root DE, Mino-Kenudson M, Brachtel EF, Driggers EM, Sabatini DM

Functional genomics reveal that the serine synthesis pathway is essential in breast cancer.

Nature , 2011 Aug 18; 476(7360):346-50. Epub 2011 Aug 18

PubMed ID: 21760589 DOI: 10.1038/nature10350

Polet F, Corbet C, Pinto A, Rubio LI, Martherus R, Bol V, Drozak X, Grégoire V, Riant O, Feron O

Reducing the serine availability complements the inhibition of the glutamine metabolism to block leukemia cell growth

Oncotarget , 1/01/01; 7(2):1765-1776. Epub 2015 Nov 28

PubMed ID: 26625201 DOI: 10.18632/oncotarget.6426

Did we miss your publication?

Have you published using HPA021241? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch