Enhanced Validation

Anti-PGAM5 Antibody

phosphoglycerate mutase family member 5
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human PGAM5
Alternative Gene Names
BXLBv68, MGC5352
Price
$445.00
Product Number
HPA036978
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
phosphoglycerate mutase family member 5
Target Gene
PGAM5
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000029500 (94%)

Rat ENSRNOG00000037443 (92%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-PGAM5 HPA036979.

Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
phosphoglycerate mutase family member 5
Gene Name
PGAM5
Alternative Gene Names
BXLBv68, MGC5352
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000247077 on the Human Protein Atlas

Zhao T, Goedhart CM, Sam PN, Sabouny R, Lingrell S, Cornish AJ, Lamont RE, Bernier FP, Sinasac D, Parboosingh JS, Care4Rare Canada Consortium, Vance JE, Claypool SM, Innes AM, Shutt TE

PISD is a mitochondrial disease gene causing skeletal dysplasia, cataracts, and white matter changes

Life Sci Alliance , 2019 Mar 11; 2(2):e201900353. Epub 2019 Mar 11

PubMed ID: 30858161 DOI: 10.26508/lsa.201900353

Holze C, Michaudel C, Mackowiak C, Haas DA, Benda C, Hubel P, Pennemann FL, Schnepf D, Wettmarshausen J, Braun M, Leung DW, Amarasinghe GK, Perocchi F, Staeheli P, Ryffel B, Pichlmair A

Oxeiptosis – a ROS induced caspase-independent apoptosis-like cell death pathway

Nat Immunol , 2017 Dec 18; 19(2):130-140. Epub 2017 Dec 18

PubMed ID: 29255269 DOI: 10.1038/s41590-017-0013-y

Did we miss your publication?

Have you published using HPA036978? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch