Enhanced Validation

Polyclonal Anti-PES1 Antibody

pescadillo ribosomal biogenesis factor 1
References (2)
Recommended Applications
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PES1
Alternative Gene Names
PES
Open Datasheet
Price
$505.00
Product Number
HPA062439
Unit Size
Concentration
Lot dependent
Availability
3 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human hippocampus shows strong nucleolar positivity in neuronal cells.
Show all images
[1 pictures]
Western blot analysis using Anti-PES1 antibody HPA062439 (A) shows similar pattern to independent antibody HPA040210 (B).

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
pescadillo ribosomal biogenesis factor 1
Target Gene
PES1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QWVFDSVNARLLLPVAEYFSGVQLPPHLSPFVTEKEGDYVPPEKLKLLALQRGEDPGNLNESEEE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000004515 (89%)

Mouse ENSMUSG00000020430 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA062439 on the Human Protein Atlas
Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Protein Name
pescadillo ribosomal biogenesis factor 1
Gene Name
PES1
Alternative Gene Names
PES
UniProt ID
O00541
Gene (Ensembl)
ENSG00000100029
Entrez Gene ID
Entrez gene: 23481
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000100029 on the Human Protein Atlas

Sun Y, Zheng W, Guo Z, Ju Q, Zhu L, Gao J, Zhou L, Liu F, Xu Y, Zhan Q, Zhou Z, Sun W, Zhao X

A novel TP53 pathway influences the HGS-mediated exosome formation in colorectal cancer

Sci Rep , 2016 Jun 17; 6:28083. Epub 2016 Jun 17

PubMed ID: 27312428 DOI: 10.1038/srep28083

Did we miss your publication?

Have you published using HPA062439? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-PES1 (HPA040210)
Anti-PES1 (HPA066670)
Corresponding Antigens
PrEST Antigen PES1 (APrEST86034)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch