Enhanced Validation

Anti-PDIA3 Antibody

protein disulfide isomerase family A, member 3
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human PDIA3
Alternative Gene Names
ERp57, ERp60, ERp61, GRP57, GRP58, HsT17083, P58, PI-PLC
Price
$437.00
Product Number
HPA003230
Unit Size
100 µl
Concentration
Lot dependent
Availability
2 in Stock
Ships
Ready to Ship
Target protein
protein disulfide isomerase family A, member 3
Target gene
PDIA3
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000015018 (91%)

Mouse ENSMUSG00000027248 (91%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-PDIA3 HPA002645.

Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Genetic validation in WB by siRNA knockdown.

Protein Name
protein disulfide isomerase family A, member 3
Gene Name
PDIA3
Alternative Gene Names
ERp57, ERp60, ERp61, GRP57, GRP58, HsT17083, P58, PI-PLC
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000167004 on the Human Protein Atlas

A. PODYMA-INOUE K, MORIWAKI T, R. RAJAPAKSHE A, TERASAWA K, HARA-YOKOYAMA M

Characterization of Heparan Sulfate Proteoglycan-positive Recycling Endosomes Isolated from Glioma Cells

Cancer Genomics Proteomics , 2016 Nov 12; 13(6):443-452. Epub 2016 Oct 8

PubMed ID: 27807067 DOI: 10.21873/cgp.20007

Bechor E, Dahan I, Fradin T, Berdichevsky Y, Zahavi A, Federman Gross A, Rafalowski M, Pick E

The dehydrogenase region of the NADPH oxidase component Nox2 acts as a protein disulfide isomerase (PDI) resembling PDIA3 with a role in the binding of the activator protein p67phox

Front Chem , 2015; 3:3. Epub 2015 Feb 4

PubMed ID: 25699251 DOI: 10.3389/fchem.2015.00003

Feng H, Li X, Chan V, Chen WN

Proteomics Based Identification of Cell Migration Related Proteins in HBV Expressing HepG2 Cells

PLoS One , 2014; 9(4):e95621. Epub 2014 Apr 24

PubMed ID: 24763314 DOI: 10.1371/journal.pone.0095621

Logan CV, Szabadkai G, Sharpe JA, Parry DA, Torelli S, Childs AM, Kriek M, Phadke R, Johnson CA, Roberts NY, Bonthron DT, Pysden KA, Whyte T, Munteanu I, Foley AR, Wheway G, Szymanska K, Natarajan S, Abdelhamed ZA, Morgan JE, Roper H, Santen GW, Niks EH, van der Pol WL, Lindhout D, Raffaello A, De Stefani D, den Dunnen JT, Sun Y, Ginjaar I, Sewry CA, Hurles M, Rizzuto R, UK10K Consortium, Duchen MR, Muntoni F, Sheridan E

Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling.

Nat Genet , 2014 Feb; 46(2):188-93. Epub 2013 Dec 15

PubMed ID: 24336167 DOI: 10.1038/ng.2851

Racapé M, Duong Van Huyen JP, Danger R, Giral M, Bleicher F, Foucher Y, Pallier A, Pilet P, Tafelmeyer P, Ashton-Chess J, Dugast E, Pettré S, Charreau B, Soulillou JP, Brouard S

The Involvement of SMILE/TMTC3 in Endoplasmic Reticulum Stress Response

PLoS One , 2011; 6(5):e19321. Epub 2011 May 16

PubMed ID: 21603654 DOI: 10.1371/journal.pone.0019321

Did we miss your publication?

Have you published using HPA003230? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch