Enhanced Validation

Anti-PDCD4 Antibody

programmed cell death 4 (neoplastic transformation inhibitor)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human PDCD4
Alternative Gene Names
H731
Price
$437.00
Product Number
HPA001032
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
programmed cell death 4 (neoplastic transformation inhibitor)
Target gene
PDCD4
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKE
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000014779 (98%)

Mouse ENSMUSG00000024975 (98%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
programmed cell death 4 (neoplastic transformation inhibitor)
Gene Name
PDCD4
Alternative Gene Names
H731
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000150593 on the Human Protein Atlas

Nicolè L, Cappellesso R, Sanavia T, Guzzardo V, Fassina A

MiR-21 over-expression and Programmed Cell Death 4 down-regulation features malignant pleural mesothelioma

Oncotarget , 2018 Apr 3; 9(25):17300-17308. Epub 2018 Apr 3

PubMed ID: 29707109 DOI: 10.18632/oncotarget.24644

Mian C, Pennelli G, Fassan M, Balistreri M, Barollo S, Cavedon E, Galuppini F, Pizzi M, Vianello F, Pelizzo MR, Girelli ME, Rugge M, Opocher G

MicroRNA Profiles in Familial and Sporadic Medullary Thyroid Carcinoma: Preliminary Relationships with RET Status and Outcome

Thyroid , 2012 Sep; 22(9):890-896

PubMed ID: 22747440 DOI: 10.1089/thy.2012.0045

Fassan M, Realdon S, Pizzi M, Balistreri M, Battaglia G, Zaninotto G, Ancona E, Rugge M

Programmed cell death 4 nuclear loss and miR-21 or activated Akt overexpression in esophageal squamous cell carcinogenesis.

Dis Esophagus , 2012 Apr; 25(3):263-8. Epub 2011 Aug 24

PubMed ID: 21883657 DOI: 10.1111/j.1442-2050.2011.01236.x

Fassan M, Pizzi M, Giacomelli L, Mescoli C, Ludwig K, Pucciarelli S, Rugge M

PDCD4 nuclear loss inversely correlates with miR-21 levels in colon carcinogenesis.

Virchows Arch , 2011 Apr; 458(4):413-9. Epub 2011 Jan 29

PubMed ID: 21279518 DOI: 10.1007/s00428-011-1046-5

Fassan M, Pizzi M, Battaglia G, Giacomelli L, Parente P, Bocus P, Ancona E, Rugge M

Programmed cell death 4 (PDCD4) expression during multistep Barrett's carcinogenesis

J Clin Pathol , 2010 Aug; 63(8):692-696. Epub 2010 Aug 11

PubMed ID: 20702469 DOI: 10.1136/jcp.2010.078253

Baffa R, Fassan M, Volinia S, O'Hara B, Liu CG, Palazzo JP, Gardiman M, Rugge M, Gomella LG, Croce CM, Rosenberg A

MicroRNA expression profiling of human metastatic cancers identifies cancer gene targets.

J Pathol , 2009 Oct; 219(2):214-21

PubMed ID: 19593777 DOI: 10.1002/path.2586

Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M

Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics

Mol Cell Proteomics , 2009 Jul; 8(7):1612-1622. Epub 2009 Apr 7

PubMed ID: 19351664 DOI: 10.1074/mcp.M800539-MCP200

Ek S, Andréasson U, Hober S, Kampf C, Pontén F, Uhlén M, Merz H, Borrebaeck CA

From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies.

Mol Cell Proteomics , 2006 Jun; 5(6):1072-81. Epub 2006 Mar 8

PubMed ID: 16524965 DOI: 10.1074/mcp.M600077-MCP200

Did we miss your publication?

Have you published using HPA001032? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch