Enhanced Validation

Anti-PCP4 Antibody

Purkinje cell protein 4
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human PCP4
Alternative Gene Names
PEP-19
Price
$437.00
Product Number
HPA005792
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
Purkinje cell protein 4
Target gene
PCP4
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000000159 (96%)

Rat ENSRNOG00000001628 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
Purkinje cell protein 4
Gene Name
PCP4
Alternative Gene Names
PEP-19
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000183036 on the Human Protein Atlas

Fernandez-Lamo I, Gomez-Dominguez D, Sanchez-Aguilera A, Oliva A, Morales AV, Valero M, Cid E, Berenyi A, Menendez de la Prida L

Proximodistal Organization of the CA2 Hippocampal Area

Cell Rep , 2019 Feb 12; 26(7):1734-1746.e6. Epub 2019 Feb 12

PubMed ID: 30759386 DOI: 10.1016/j.celrep.2019.01.060

Leroy F, Park J, Asok A, Brann DH, Meira T, Boyle L, Buss EW, Kandel ER, Siegelbaum SA

A hippocampal CA2 to lateral septal circuit disinhibits social aggression

Nature , 2018 Dec 5; 564(7735):213-218. Epub 2018 Dec 5

PubMed ID: 30518859 DOI: 10.1038/s41586-018-0772-0

Cembrowski MS, Wang L, Lemire AL, Copeland M, DiLisio SF, Clements J, Spruston N

The subiculum is a patchwork of discrete subregions

eLife , 2018 Oct 30; 7:e37701. Epub 2018 Oct 30

PubMed ID: 30375971 DOI: 10.7554/eLife.37701

Dominic S. Berns, Laura A. DeNardo, Daniel T. Pederick, Liqun Luo

Teneurin-3 controls topographic circuit assembly in the hippocampus

Nature , 554, 328-333 (2018)

DOI: 10.1038/nature25463

Leroy F, Brann DH, Meira T, Siegelbaum SA

Input-timing dependent plasticity in the hippocampal CA2 region and its potential role in social memory

Neuron , 2017 Aug 17; 95(5):1089-1102.e5. Epub 2017 Aug 17

PubMed ID: 28823730 DOI: 10.1016/j.neuron.2017.07.036

Ray S, Burgalossi A, Brecht M, Naumann RK

Complementary Modular Microcircuits of the Rat Medial Entorhinal Cortex

Front Syst Neurosci , 2017 Apr 10; 11:20. Epub 2017 Apr 10

PubMed ID: 28443003 DOI: 10.3389/fnsys.2017.00020

Fernández-Ruiz A, Oliva A, Nagy GA, Maurer AP, Berényi A, Buzsáki G

Entorhinal–CA3 dual-input control of spike timing in the hippocampus by theta-gamma coupling

Neuron , 2017 Mar 8; 93(5):1213-1226.e5

PubMed ID: 28279355 DOI: 10.1016/j.neuron.2017.02.017

Srinivas KV, Buss EW, Sun Q, Santoro B, Takahashi H, Nicholson DA, Siegelbaum SA

The Dendrites of CA2 and CA1 Pyramidal Neurons Differentially Regulate Information Flow in the Cortico-Hippocampal Circuit

J Neurosci , 2017 Mar 22; 37(12):3276-3293

PubMed ID: 28213444 DOI: 10.1523/JNEUROSCI.2219-16.2017

Lopez-Pigozzi D, Laurent F, Brotons-Mas JR, Valderrama M, Valero M, Fernandez-Lamo I, Cid E, Gomez-Dominguez D, Gal B, Menendez de la Prida L

Altered Oscillatory Dynamics of CA1 Parvalbumin Basket Cells during Theta–Gamma Rhythmopathies of Temporal Lobe Epilepsy

eNeuro , 2016 Nov 18; 3(6):ENEURO.0284-16.2016. Epub 2016 Nov 18

PubMed ID: 27896315 DOI: 10.1523/ENEURO.0284-16.2016

Ray S, Brecht M

Structural development and dorsoventral maturation of the medial entorhinal cortex

eLife , 2016 Apr 2; 5:e13343. Epub 2016 Apr 2

PubMed ID: 27036175 DOI: 10.7554/eLife.13343

Valero M, Cid E, Averkin RG, Aguilar J, Sanchez-Aguilera A, Viney TJ, Gomez-Dominguez D, Bellistri E, de la Prida LM

Determinants of different deep and superficial CA1 pyramidal cell dynamics during sharp-wave ripples

Nat Neurosci , 2015 Sep; 18(9):1281-1290. Epub 2015 Jul 27

PubMed ID: 26214372 DOI: 10.1038/nn.4074

Zhou J, Shaikh LH, Neogi SG, McFarlane I, Zhao W, Figg N, Brighton CA, Maniero C, Teo AE, Azizan EA, Brown MJ

DACH1, a Zona Glomerulosa Selective Gene in the Human Adrenal, Activates Transforming Growth Factor-β Signaling and Suppresses Aldosterone Secretion

Hypertension , 2015 May; 65(5):1103-1110. Epub 2015 Apr 8

PubMed ID: 25776071 DOI: 10.1161/HYP.0000000000000025

Botcher NA, Falck JE, Thomson AM, Mercer A

Distribution of interneurons in the CA2 region of the rat hippocampus

Front Neuroanat , 2014; 8:104. Epub 2014 Sep 26

PubMed ID: 25309345 DOI: 10.3389/fnana.2014.00104

Hitti FL, Siegelbaum SA

The hippocampal CA2 region is essential for social memory

Nature , 2014 Apr 3; 508(7494):88-92. Epub 2014 Feb 23

PubMed ID: 24572357 DOI: 10.1038/nature13028

Kohara K, Pignatelli M, Rivest AJ, Jung HY, Kitamura T, Suh J, Frank D, Kajikawa K, Mise N, Obata Y, Wickersham IR, Tonegawa S

Cell type-specific genetic and optogenetic tools reveal hippocampal CA2 circuits.

Nat Neurosci , 2014 Feb; 17(2):269-79. Epub 2013 Dec 15

PubMed ID: 24336151 DOI: 10.1038/nn.3614

Did we miss your publication?

Have you published using HPA005792? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch