Anti-PAX6 Antibody

paired box 6
Recommended Applications
Product Description
Polyclonal Antibody against Human PAX6
Alternative Gene Names
AN, AN2, D11S812E, WAGR
Price
$445.00
Product Number
HPA030775
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
paired box 6
Target Gene
PAX6
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000004410 (100%)

Mouse ENSMUSG00000027168 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
paired box 6
Gene Name
PAX6
Alternative Gene Names
AN, AN2, D11S812E, WAGR
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000007372 on the Human Protein Atlas

Tang Y, Liu ML, Zang T, Zhang CL

Direct Reprogramming Rather than iPSC-Based Reprogramming Maintains Aging Hallmarks in Human Motor Neurons

Front Mol Neurosci , 2017 Nov 2; 10:359. Epub 2017 Nov 2

PubMed ID: 29163034 DOI: 10.3389/fnmol.2017.00359

Hoelzl MA, Heby-Henricson K, Gerling M, Dias JM, Kuiper RV, Trünkle C, Bergström Å, Ericson J, Toftgård R, Teglund S

Differential requirement of SUFU in tissue development discovered in a hypomorphic mouse model

Dev Biol , 2017 Jul 5; 429(1):132-146. Epub 2017 Jul 5

PubMed ID: 28688895 DOI: 10.1016/j.ydbio.2017.06.037

Johnson Chacko L, Pechriggl EJ, Fritsch H, Rask-Andersen H, Blumer MJ, Schrott-Fischer A, Glueckert R

Neurosensory Differentiation and Innervation Patterning in the Human Fetal Vestibular End Organs between the Gestational Weeks 8–12

Front Neuroanat , 2016 Nov 15; 10:111. Epub 2016 Nov 15

PubMed ID: 27895556 DOI: 10.3389/fnana.2016.00111

Fujiwara N, Cave JW

Partial Conservation between Mice and Humans in Olfactory Bulb Interneuron Transcription Factor Codes

Front Neurosci , 2016 Jul 20; 10:337. Epub 2016 Jul 20

PubMed ID: 27489533 DOI: 10.3389/fnins.2016.00337

Zhang ZN, Freitas BC, Qian H, Lux J, Acab A, Trujillo CA, Herai RH, Nguyen Huu VA, Wen JH, Joshi-Barr S, Karpiak JV, Engler AJ, Fu XD, Muotri AR, Almutairi A

Layered hydrogels accelerate iPSC-derived neuronal maturation and reveal migration defects caused by MeCP2 dysfunction

Proc Natl Acad Sci U S A , 2016/03/22; 113(12):3185-3190. Epub 2016 Mar 4

PubMed ID: 26944080 DOI: 10.1073/pnas.1521255113

Did we miss your publication?

Have you published using HPA030775? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch