Enhanced Validation

Anti-PANX1 Antibody

pannexin 1
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human PANX1
Alternative Gene Names
MRS1, PX1, UNQ2529
Price
$450.00
Product Number
HPA016930
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
pannexin 1
Target Gene
PANX1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000010060 (80%)

Mouse ENSMUSG00000031934 (77%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
pannexin 1
Gene Name
PANX1
Alternative Gene Names
MRS1, PX1, UNQ2529
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000110218 on the Human Protein Atlas

Aguilar-Perez A, Pacheco-Costa R, Atkinson EG, Deosthale P, Davis HM, Essex AL, Dilley JE, Gomez L, Rupert JE, Zimmers TA, Thompson RJ, Allen MR, Plotkin LI

Age- and sex-dependent role of osteocytic pannexin1 on bone and muscle mass and strength

Sci Rep , 2019 Sep 25; 9:13903. Epub 2019 Sep 25

PubMed ID: 31554905 DOI: 10.1038/s41598-019-50444-1

Tozzi M, Larsen AT, Lange SC, Giannuzzo A, Andersen MN, Novak I

The P2X7 receptor and pannexin-1 are involved in glucose-induced autocrine regulation in β-cells

Sci Rep , 2018 Jun 12; 8:8926. Epub 2018 Jun 12

PubMed ID: 29895988 DOI: 10.1038/s41598-018-27281-9

Boucher J, Simonneau C, Denet G, Clarhaut J, Balandre AC, Mesnil M, Cronier L, Monvoisin A

Pannexin-1 in Human Lymphatic Endothelial Cells Regulates Lymphangiogenesis

Int J Mol Sci , 2018 May 24; 19(6):1558. Epub 2018 May 24

PubMed ID: 29882918 DOI: 10.3390/ijms19061558

Basova LV, Tang X, Umasume T, Gromova A, Zyrianova T, Shmushkovich T, Wolfson A, Hawley D, Zoukhri D, Shestopalov VI, Makarenkova HP

Manipulation of Panx1 Activity Increases the Engraftment of Transplanted Lacrimal Gland Epithelial Progenitor Cells

Invest Ophthalmol Vis Sci , 2017 Nov; 58(13):5654-5665

PubMed ID: 29098296 DOI: 10.1167/iovs.17-22071

Horton SM, Luna Lopez C, Blevins E, Howarth H, Weisberg J, Shestopalov VI, Makarenkova HP, Shah SB

Pannexin 1 Modulates Axonal Growth in Mouse Peripheral Nerves

Front Cell Neurosci , 2017 Nov 22; 11:365. Epub 2017 Nov 22

PubMed ID: 29213230 DOI: 10.3389/fncel.2017.00365

Maes M, McGill MR, da Silva TC, Abels C, Lebofsky M, Weemhoff JL, Tiburcio T, Pereira IV, Willebrords J, Yanguas SC, Farhood A, Beschin A, Van Ginderachter JA, Penuela S, Jaeschke H, Cogliati B, Vinken M

Inhibition of pannexin1 channels alleviates acetaminophen-induced hepatotoxicity

Arch Toxicol , 2016 Nov 8; 91(5):2245-2261. Epub 2016 Nov 8

PubMed ID: 27826632 DOI: 10.1007/s00204-016-1885-6

Did we miss your publication?

Have you published using HPA016930? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch