Anti-PAGE2B Antibody

P antigen family, member 2B
Recommended Applications
Product Description
Polyclonal Antibody against Human PAGE2B
Alternative Gene Names
CT16.5
Price
$445.00
Product Number
HPA052619
Unit Size
Concentration
Lot dependent
Availability
8 in Stock
Ships
Ready to Ship
Target Protein
P antigen family, member 2B
Target Gene
PAGE2B
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QGIAPSGEIENEGAPAVQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000024347 (37%)

Rat ENSRNOG00000019177 (35%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Protocols
Protein Name
P antigen family, member 2B
Gene Name
PAGE2B
Alternative Gene Names
CT16.5
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000238269 on the Human Protein Atlas

Zandian A, Wingård L, Nilsson H, Sjöstedt E, Johansson DX, Just D, Hellström C, Uhlén M, Schwenk JM, Häggmark-Månberg A, Norbeck O, Owe-Larsson B, Nilsson P, Persson MA

Untargeted screening for novel autoantibodies with prognostic value in first-episode psychosis

Transl Psychiatry , 2017 Jul 25; 7(7):e1177-. Epub 2017 Jul 25

PubMed ID: 28742074 DOI: 10.1038/tp.2017.160

Djureinovic D, Hallström BM, Horie M, Mattsson JS, La Fleur L, Fagerberg L, Brunnström H, Lindskog C, Madjar K, Rahnenführer J, Ekman S, Ståhle E, Koyi H, Brandén E, Edlund K, Hengstler JG, Lambe M, Saito A, Botling J, Pontén F, Uhlén M, Micke P

Profiling cancer testis antigens in non–small-cell lung cancer

JCI Insight , 2016 Jul 7; 1(10):e86837. Epub 2016 Jul 7

PubMed ID: 27699219 DOI: 10.1172/jci.insight.86837

Did we miss your publication?

Have you published using HPA052619? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch