Enhanced Validation

Anti-OSTM1 Antibody

osteopetrosis associated transmembrane protein 1
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human OSTM1
Alternative Gene Names
GL, HSPC019
Price
$450.00
Product Number
HPA010851
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
osteopetrosis associated transmembrane protein 1
Target Gene
OSTM1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
REAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000037647 (89%)

Mouse ENSMUSG00000038280 (85%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
osteopetrosis associated transmembrane protein 1
Gene Name
OSTM1
Alternative Gene Names
GL, HSPC019
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000081087 on the Human Protein Atlas

Bosman EA, Estabel J, Ismail O, Podrini C, White JK, Steel KP

Omi, a recessive mutation on chromosome 10, is a novel allele of Ostm1

Mamm Genome , 2013 Feb; 24(1-2):44-53. Epub 2012 Nov 17

PubMed ID: 23160729 DOI: 10.1007/s00335-012-9438-7

Majumdar A, Capetillo-Zarate E, Cruz D, Gouras GK, Maxfield FR

Degradation of Alzheimer's amyloid fibrils by microglia requires delivery of ClC-7 to lysosomes.

Mol Biol Cell , 2011 May 15; 22(10):1664-76. Epub 2011 Mar 25

PubMed ID: 21441306 DOI: 10.1091/mbc.E10-09-0745

Did we miss your publication?

Have you published using HPA010851? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch