Anti-ORAI3 Antibody

ORAI calcium release-activated calcium modulator 3
Recommended Applications
Product Description
Polyclonal Antibody against Human ORAI3
Alternative Gene Names
MGC13024, TMEM142C
Price
$437.00
Product Number
HPA015022
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
ORAI calcium release-activated calcium modulator 3
Target gene
ORAI3
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
APLDTPTPMVPTSRVPGTLAPVATSLSPASNLPRSSASAAPSQAEPACPPRQACGGGGAHGPGWQA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000039730 (63%)

Mouse ENSMUSG00000043964 (58%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Protein Name
ORAI calcium release-activated calcium modulator 3
Gene Name
ORAI3
Alternative Gene Names
MGC13024, TMEM142C
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000175938 on the Human Protein Atlas

Zuccolo E, Laforenza U, Ferulli F, Pellavio G, Scarpellino G, Tanzi M, Turin I, Faris P, Lucariello A, Maestri M, Kheder DA, Guerra G, Pedrazzoli P, Montagna D, Moccia F

Stim and Orai mediate constitutive Ca2+ entry and control endoplasmic reticulum Ca2+ refilling in primary cultures of colorectal carcinoma cells

Oncotarget , 2018 Jul 24; 9(57):31098-31119. Epub 2018 Jul 24

PubMed ID: 30123430 DOI: 10.18632/oncotarget.25785

Lodola F, Laforenza U, Cattaneo F, Ruffinatti FA, Poletto V, Massa M, Tancredi R, Zuccolo E, Khdar DA, Riccardi A, Biggiogera M, Rosti V, Guerra G, Moccia F

VEGF-induced intracellular Ca2+ oscillations are down-regulated and do not stimulate angiogenesis in breast cancer-derived endothelial colony forming cells

Oncotarget , 2017 Aug 14; 8(56):95223-95246. Epub 2017 Aug 14

PubMed ID: 29221123 DOI: 10.18632/oncotarget.20255

Dragoni S, Laforenza U, Bonetti E, Reforgiato M, Poletto V, Lodola F, Bottino C, Guido D, Rappa A, Pareek S, Tomasello M, Guarrera MR, Cinelli MP, Aronica A, Guerra G, Barosi G, Tanzi F, Rosti V, Moccia F

Enhanced Expression of Stim, Orai, and TRPC Transcripts and Proteins in Endothelial Progenitor Cells Isolated from Patients with Primary Myelofibrosis

PLoS One , 2014; 9(3):e91099. Epub 2014 Mar 6

PubMed ID: 24603752 DOI: 10.1371/journal.pone.0091099

Dragoni S, Turin I, Laforenza U, Potenza DM, Bottino C, Glasnov TN, Prestia M, Ferulli F, Saitta A, Mosca A, Guerra G, Rosti V, Luinetti O, Ganini C, Porta C, Pedrazzoli P, Tanzi F, Montagna D, Moccia F

Store-Operated Ca2+ Entry Does Not Control Proliferation in Primary Cultures of Human Metastatic Renal Cellular Carcinoma

Biomed Res Int , 2014; 2014:739494. Epub 2014 Jul 9

PubMed ID: 25126575 DOI: 10.1155/2014/739494

Did we miss your publication?

Have you published using HPA015022? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens