Enhanced Validation

Anti-ODF2 Antibody

outer dense fiber of sperm tails 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human ODF2
Alternative Gene Names
CT134, ODF84
Price
$450.00
Product Number
HPA001874
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
outer dense fiber of sperm tails 2
Target Gene
ODF2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000014584 (99%)

Mouse ENSMUSG00000026790 (99%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
outer dense fiber of sperm tails 2
Gene Name
ODF2
Alternative Gene Names
CT134, ODF84
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000136811 on the Human Protein Atlas

Chong WM, Wang WJ, Lo CH, Chiu TY, Chang TJ, Liu YP, Tanos B, Mazo G, Tsou MF, Jane WN, Yang TT, Liao JC

Super-resolution microscopy reveals coupling between mammalian centriole subdistal appendages and distal appendages

eLife , 2020 Apr 3; 9:e53580. Epub 2020 Apr 3

PubMed ID: 32242819 DOI: 10.7554/eLife.53580

Loukil A, Tormanen K, Sütterlin C

The daughter centriole controls ciliogenesis by regulating Neurl-4 localization at the centrosome

J Cell Biol , 2017 May 1; 216(5):1287-1300

PubMed ID: 28385950 DOI: 10.1083/jcb.201608119

Mazo G, Soplop N, Wang WJ, Uryu K, Tsou MF

Spatial control of primary ciliogenesis by subdistal appendages alters sensation-associated properties of cilia

Dev Cell , 2016 Nov 3; 39(4):424-437. Epub 2016 Nov 3

PubMed ID: 27818179 DOI: 10.1016/j.devcel.2016.10.006

Cortés CR, McInerney-Leo AM, Vogel I, Rondón Galeano MC, Leo PJ, Harris JE, Anderson LK, Keith PA, Brown MA, Ramsing M, Duncan EL, Zankl A, Wicking C

Mutations in human C2CD3 cause skeletal dysplasia and provide new insights into phenotypic and cellular consequences of altered C2CD3 function

Sci Rep , 2016 Apr 20; 6:24083. Epub 2016 Apr 20

PubMed ID: 27094867 DOI: 10.1038/srep24083

Asante D, Stevenson NL, Stephens DJ

Subunit composition of the human cytoplasmic dynein-2 complex

J Cell Sci , 2014 Nov 1; 127(21):4774-4787

PubMed ID: 25205765 DOI: 10.1242/jcs.159038

Asante D, MacCarthy-Morrogh L, Townley AK, Weiss MA, Katayama K, Palmer KJ, Suzuki H, Westlake CJ, Stephens DJ

A role for the Golgi matrix protein giantin in ciliogenesis through control of the localization of dynein-2

J Cell Sci , 2013 Nov 15; 126(22):5189-5197

PubMed ID: 24046448 DOI: 10.1242/jcs.131664

Baron Gaillard CL, Pallesi-Pocachard E, Massey-Harroche D, Richard F, Arsanto JP, Chauvin JP, Lecine P, Krämer H, Borg JP, Le Bivic A

Hook2 is involved in the morphogenesis of the primary cilium.

Mol Biol Cell , 2011 Dec; 22(23):4549-62. Epub 2011 Oct 12

PubMed ID: 21998199 DOI: 10.1091/mbc.E11-05-0405

Did we miss your publication?

Have you published using HPA001874? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch