Enhanced Validation

Anti-NSDHL Antibody

NAD(P) dependent steroid dehydrogenase-like
References (3)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human NSDHL
Alternative Gene Names
H105e3, SDR31E1, XAP104
Open Datasheet
Price
$450.00
Product Number
HPA000571
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[6 pictures]
Immunohistochemistry analysis in human epididymis and lymph node tissues using Anti-NSDHL antibody. Corresponding NSDHL RNA-seq data are presented for the same tissues.
Show all images
[2 pictures]
Western blot analysis using Anti-NSDHL antibody HPA000571 (A) shows similar pattern to independent antibody HPA000248 (B).
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
NAD(P) dependent steroid dehydrogenase-like
Target Gene
NSDHL
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LPYAMKPIDYYTETKILQERAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGNGKNLVDFTFVENVVHGHILAAEQLSRDSTLGGKAFHITNDEPIPFWTFLSRI
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000057814 (92%)

Mouse ENSMUSG00000031349 (91%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-NSDHL HPA000248.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA000571 on the Human Protein Atlas
Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA000571 on the Human Protein Atlas
Protein Name
NAD(P) dependent steroid dehydrogenase-like
Gene Name
NSDHL
Alternative Gene Names
H105e3, SDR31E1, XAP104
UniProt ID
Q15738
Gene (Ensembl)
ENSG00000147383
Entrez Gene ID
Entrez gene: 50814
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000147383 on the Human Protein Atlas

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

Li M, Aliotta JM, Asara JM, Wu Q, Dooner MS, Tucker LD, Wells A, Quesenberry PJ, Ramratnam B

Intercellular transfer of proteins as identified by stable isotope labeling of amino acids in cell culture.

J Biol Chem , 2010 Feb 26; 285(9):6285-97. Epub 2009 Dec 21

PubMed ID: 20026604 DOI: 10.1074/jbc.M109.057943

Did we miss your publication?

Have you published using HPA000571? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-NSDHL (HPA000248)
Corresponding Antigens
PrEST Antigen NSDHL (APrEST74028)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch