Enhanced Validation

Polyclonal Anti-NSD2 Antibody

nuclear receptor binding SET domain protein 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human NSD2
Alternative Gene Names
KMT3G, MMSET, WHSC1
Price
$459.00
Product Number
HPA015801
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
nuclear receptor binding SET domain protein 2
Target Gene
NSD2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGD
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000057406 (91%)

Rat ENSRNOG00000038140 (91%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
nuclear receptor binding SET domain protein 2
Gene Name
NSD2
Alternative Gene Names
KMT3G, MMSET, WHSC1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000109685 on the Human Protein Atlas

Dong P, Xiong Y, Yue J, Hanley SJ, Watari H

miR-34a, miR-424 and miR-513 inhibit MMSET expression to repress endometrial cancer cell invasion and sphere formation

Oncotarget , 2018 May 1; 9(33):23253-23263. Epub 2018 May 1

PubMed ID: 29796186 DOI: 10.18632/oncotarget.25298

Dilg D, Saleh RN, Phelps SE, Rose Y, Dupays L, Murphy C, Mohun T, Anderson RH, Scambler PJ, Chapgier AL

HIRA Is Required for Heart Development and Directly Regulates Tnni2 and Tnnt3

PLoS One , 2016 Aug 12; 11(8):e0161096. Epub 2016 Aug 12

PubMed ID: 27518902 DOI: 10.1371/journal.pone.0161096

Toyokawa G, Cho HS, Masuda K, Yamane Y, Yoshimatsu M, Hayami S, Takawa M, Iwai Y, Daigo Y, Tsuchiya E, Tsunoda T, Field HI, Kelly JD, Neal DE, Maehara Y, Ponder BA, Nakamura Y, Hamamoto R

Histone Lysine Methyltransferase Wolf-Hirschhorn Syndrome Candidate 1 Is Involved in Human Carcinogenesis through Regulation of the Wnt Pathway

Neoplasia , 2011 Oct; 13(10):887-898

PubMed ID: 22028615 DOI: 10.1593/neo.11048

Did we miss your publication?

Have you published using HPA015801? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch