Enhanced Validation

Anti-NR3C1 Antibody

nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Recommended Applications
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human NR3C1
Alternative Gene Names
GR, GRL
Price
$445.00
Product Number
HPA004248
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Target Gene
NR3C1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000024431 (72%)

Rat ENSRNOG00000048800 (71%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Recombinant expression validation in WB using target protein overexpression.

Protein Name
nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Gene Name
NR3C1
Alternative Gene Names
GR, GRL
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000113580 on the Human Protein Atlas

Zheng G, Victor Fon G, Meixner W, Creekmore A, Zong Y, K. Dame M, Colacino J, Dedhia PH, Hong S, Wiley JW

Chronic stress and intestinal barrier dysfunction: Glucocorticoid receptor and transcription repressor HES1 regulate tight junction protein Claudin-1 promoter

Sci Rep , 2017 Jul 3; 7:4502. Epub 2017 Jul 3

PubMed ID: 28674421 DOI: 10.1038/s41598-017-04755-w

Kim KH, Lee JM, Zhou Y, Harpavat S, Moore DD

Glucocorticoids Have Opposing Effects on Liver Fibrosis in Hepatic Stellate and Immune Cells

Mol Endocrinol , 2016 Jun 29; 30(8):905-916. Epub 2016 Jun 29

PubMed ID: 27355192 DOI: 10.1210/me.2016-1029

Did we miss your publication?

Have you published using HPA004248? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch