Polyclonal Anti-NODAL Antibody

nodal growth differentiation factor
References (1)
Recommended Applications
Product Description
Polyclonal Antibody against Human NODAL
Open Datasheet
Price
$505.00
Product Number
HPA045201
Unit Size
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Show all images
[1 pictures]
Western blot analysis in control (vector only transfected HEK293T lysate) and NODAL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402640).

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
nodal growth differentiation factor
Target Gene
NODAL
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PTEGSLAIEIFHQPKPDTEQASDSCLERFQMDLFTVTLSQVTFSLGSMVLEVTRPLSKWLKHPGALEKQMSRV
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000037171 (64%)

Rat ENSRNOG00000000556 (64%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA045201 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
nodal growth differentiation factor
Gene Name
NODAL
UniProt ID
Q96S42
Gene (Ensembl)
ENSG00000156574
Entrez Gene ID
Entrez gene: 4838
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000156574 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA045201? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen NODAL (APrEST74083)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch