Enhanced Validation

Anti-NLK Antibody

nemo-like kinase
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human NLK
Price
$437.00
Product Number
HPA018192
Unit Size
100 µl
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target protein
nemo-like kinase
Target gene
NLK
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000017376 (100%)

Rat ENSRNOG00000008704 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
nemo-like kinase
Gene Name
NLK
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000087095 on the Human Protein Atlas

Suwei D, Liang Z, Zhimin L, Ruilei L, Yingying Z, Zhen L, Chunlei G, Zhangchao L, Yuanbo X, Jinyan Y, Gaofeng L, Xin S

NLK functions to maintain proliferation and stemness of NSCLC and is a target of metformin

J Hematol Oncol , 2015 Oct 26; 8:120. Epub 2015 Oct 26

PubMed ID: 26503334 DOI: 10.1186/s13045-015-0203-8

Zhang B, Li KY, Chen HY, Pan SD, Chen SF, Zhang WF, Xia CP, Jiang LC, Liu XB, Zhao FJ, Yuan DY, Wang LX, Wu YP, Liu SW

Lentivirus-based RNA Silencing of Nemo-like Kinase (NLK) Inhibits the CAL 27 Human Adenosquamos Carcinoma Cells Proliferation and Blocks G0/G1 Phase to S Phase

Int J Med Sci , 2013; 10(10):1301-1306. Epub 2013 Aug 8

PubMed ID: 23983589 DOI: 10.7150/ijms.6607

Did we miss your publication?

Have you published using HPA018192? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch