Enhanced Validation

Anti-NFATC2 Antibody

nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human NFATC2
Alternative Gene Names
NF-ATP, NFAT1, NFATp
Price
$437.00
Product Number
HPA024369
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
Target gene
NFATC2
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTN
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000027544 (85%)

Rat ENSRNOG00000012175 (84%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
Gene Name
NFATC2
Alternative Gene Names
NF-ATP, NFAT1, NFATp
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000101096 on the Human Protein Atlas

Kenneth Peuker, Stefanie Muff, Jun Wang, Sven Künzel, Esther Bosse, Yvonne Zeissig, Giuseppina Luzzi, Marijana Basic, Anne Strigli, Andrea Ulbricht, Arthur Kaser, Alexander Arlt, Triantafyllos Chavakis, Gijs R van den Brink, Clemens Schafmayer, Jan-Hendrik Egberts, Thomas Becker, Marco E Bianchi, André Bleich, Christoph Röcken, Jochen Hampe, Stefan Schreiber, John F Baines, Richard S Blumberg, Sebastian Zeissig

Epithelial calcineurin controls microbiota-dependent intestinal tumor development

Nature Medicine , April 04, 2016

PubMed ID: 27043494 DOI: 10.1038/nm.4072

V Perotti, P Baldassari, A Molla, C Vegetti, I Bersani, A Maurichi, M Santinami, A Anichini, R Mortarini

NFATc2 is an intrinsic regulator of melanoma dedifferentiation

Oncogene , September 21, 2015

PubMed ID: 0 DOI: 10.1038/onc.2015.355

Did we miss your publication?

Have you published using HPA024369? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens