Anti-NELFCD Antibody

negative elongation factor complex member C/D
Recommended Applications
Product Description
Polyclonal Antibody against Human NELFCD
Alternative Gene Names
HSPC130, NELF-C, NELF-D, TH1, TH1L
Price
$437.00
Product Number
HPA050641
Unit Size
100 µl
Concentration
Lot dependent
Availability
7 in Stock
Ships
Ready to Ship
Target protein
negative elongation factor complex member C/D
Target gene
NELFCD
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ETVENHLKSLLIKHFDPRKADSIFTEEGETPAWLEQMIAHTTWRDLFYKLAEAHPDCLMLNFTVKLISDAGYQGEITSVS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000016253 (100%)

Rat ENSRNOG00000047874 (99%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Protein Name
negative elongation factor complex member C/D
Gene Name
NELFCD
Alternative Gene Names
HSPC130, NELF-C, NELF-D, TH1, TH1L
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000101158 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA050641? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens