Enhanced Validation

Anti-NECTIN4 Antibody

nectin cell adhesion molecule 4
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human NECTIN4
Alternative Gene Names
LNIR, nectin-4, PRR4, PVRL4
Price
$437.00
Product Number
HPA010775
Unit Size
100 µl
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target protein
nectin cell adhesion molecule 4
Target gene
NECTIN4
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPAL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000004029 (90%)

Mouse ENSMUSG00000006411 (90%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
nectin cell adhesion molecule 4
Gene Name
NECTIN4
Alternative Gene Names
LNIR, nectin-4, PRR4, PVRL4
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000143217 on the Human Protein Atlas

Allen IV, McQuaid S, Penalva R, Ludlow M, Duprex WP, Rima BK

Macrophages and Dendritic Cells Are the Predominant Cells Infected in Measles in Humans

mSphere , 2018 May 9; 3(3):e00570-17. Epub 2018 May 9

PubMed ID: 29743202 DOI: 10.1128/mSphere.00570-17

Richardson R, Mitchell K, Hammond NL, Mollo MR, Kouwenhoven EN, Wyatt ND, Donaldson IJ, Zeef L, Burgis T, Blance R, van Heeringen SJ, Stunnenberg HG, Zhou H, Missero C, Romano RA, Sinha S, Dixon MJ, Dixon J

p63 exerts spatio-temporal control of palatal epithelial cell fate to prevent cleft palate

PLoS Genet , 2017 Jun 12; 13(6):e1006828. Epub 2017 Jun 12

PubMed ID: 28604778 DOI: 10.1371/journal.pgen.1006828

Geekiyanage H, Galanis E

MiR‐31 and miR‐128 regulates poliovirus receptor‐related 4 mediated measles virus infectivity in tumors

Mol Oncol , 2016 Jul 28; 10(9):1387-1403. Epub 2016 Jul 28

PubMed ID: 27507538 DOI: 10.1016/j.molonc.2016.07.007

Did we miss your publication?

Have you published using HPA010775? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch