1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-NECAB2
Enhanced Validation

Anti-NECAB2 Antibody

N-terminal EF-hand calcium binding protein 2
References (3)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human NECAB2
Alternative Gene Names
EFCBP2
Open Datasheet
Price
$450.00
Product Number
HPA013998
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[10 pictures]
Immunohistochemistry analysis in human cerebral cortex and skin tissues using HPA013998 antibody. Corresponding NECAB2 RNA-seq data are presented for the same tissues.
Show all images
[2 pictures]
Western blot analysis in human cerebral cortex tissue.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
N-terminal EF-hand calcium binding protein 2
Target Gene
NECAB2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQL
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000031837 (98%)

Rat ENSRNOG00000015084 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-NECAB2 HPA014144.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA013998 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA013998 on the Human Protein Atlas
Protein Name
N-terminal EF-hand calcium binding protein 2
Gene Name
NECAB2
Alternative Gene Names
EFCBP2
UniProt ID
Q7Z6G3
Gene (Ensembl)
ENSG00000103154
Entrez Gene ID
Entrez gene: 54550
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000103154 on the Human Protein Atlas

Alshawaf AJ, Viventi S, Qiu W, D’Abaco G, Nayagam B, Erlichster M, Chana G, Everall I, Ivanusic J, Skafidas E, Dottori M

Phenotypic and Functional Characterization of Peripheral Sensory Neurons derived from Human Embryonic Stem Cells

Sci Rep , 2018 Jan 12; 8:603. Epub 2018 Jan 12

PubMed ID: 29330377 DOI: 10.1038/s41598-017-19093-0

Zhang MD, Tortoriello G, Hsueh B, Tomer R, Ye L, Mitsios N, Borgius L, Grant G, Kiehn O, Watanabe M, Uhlén M, Mulder J, Deisseroth K, Harkany T, Hökfelt TG

Neuronal calcium-binding proteins 1/2 localize to dorsal root ganglia and excitatory spinal neurons and are regulated by nerve injury

Proc Natl Acad Sci U S A , 2014 Mar 25; 111(12):E1149-E1158. Epub 2014 Mar 10

PubMed ID: 24616509 DOI: 10.1073/pnas.1402318111

Did we miss your publication?

Have you published using HPA013998? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-NECAB2 (AMAb90808)
Anti-NECAB2 (HPA014144)
Corresponding Antigens
PrEST Antigen NECAB2 (APrEST72715)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-NECAB2