Enhanced Validation

Polyclonal Anti-NECAB1 Antibody

N-terminal EF-hand calcium binding protein 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human NECAB1
Alternative Gene Names
EFCBP1
Price
$505.00
Product Number
HPA031262
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
N-terminal EF-hand calcium binding protein 1
Target Gene
NECAB1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFH
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000007256 (98%)

Mouse ENSMUSG00000040536 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibodies Anti-NECAB1 HPA025963, Anti-NECAB1 HPA023629.

Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Protein Name
N-terminal EF-hand calcium binding protein 1
Gene Name
NECAB1
Alternative Gene Names
EFCBP1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000123119 on the Human Protein Atlas

Sjöstedt E, Fagerberg L, Hallström BM, Häggmark A, Mitsios N, Nilsson P, Pontén F, Hökfelt T, Uhlén M, Mulder J

Defining the Human Brain Proteome Using Transcriptomics and Antibody-Based Profiling with a Focus on the Cerebral Cortex

PLoS One , 2015; 10(6):e0130028. Epub 2015 Jun 15

PubMed ID: 26076492 DOI: 10.1371/journal.pone.0130028

Did we miss your publication?

Have you published using HPA031262? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch