Enhanced Validation

Polyclonal Anti-NECAB1 Antibody

N-terminal EF-hand calcium binding protein 1
References (8)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human NECAB1
Alternative Gene Names
EFCBP1
Open Datasheet
Price
$505.00
Product Number
HPA023629
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[10 pictures]
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA023629 antibody. Corresponding NECAB1 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis using Anti-NECAB1 antibody HPA023629 (A) shows similar pattern to independent antibody HPA025963 (B).

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
N-terminal EF-hand calcium binding protein 1
Target Gene
NECAB1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000040536 (98%)

Rat ENSRNOG00000007256 (98%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibodies Anti-NECAB1 HPA031262, Anti-NECAB1 HPA025963.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA023629 on the Human Protein Atlas
Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Protein Name
N-terminal EF-hand calcium binding protein 1
Gene Name
NECAB1
Alternative Gene Names
EFCBP1
UniProt ID
Q8N987
Gene (Ensembl)
ENSG00000123119
Entrez Gene ID
Entrez gene: 64168
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000123119 on the Human Protein Atlas

Chiu YT, Deutch AY, Wang W, Schmitz GP, Huang KL, Kocak DD, Llorach P, Bowyer K, Liu B, Sciaky N, Hua K, Chen C, Mott SE, Niehaus J, DiBerto JF, English J, Walsh JJ, Scherrer G, Herman MA, Wu Z, Wetsel WC, Roth BL

A suite of engineered mice for interrogating psychedelic drug actions

bioRxiv , . Epub 2023 Sep 26

PubMed ID: 37808655 DOI: 10.1101/2023.09.25.559347

Blot FG, White JJ, van Hattem A, Scotti L, Balaji V, Adolfs Y, Pasterkamp RJ, De Zeeuw CI, Schonewille M

Purkinje cell microzones mediate distinct kinematics of a single movement

Nat Commun , 2023 Jul 19; 14:4358. Epub 2023 Jul 19

PubMed ID: 37468512 DOI: 10.1038/s41467-023-40111-5

Takemoto M, Kato S, Kobayashi K, Song WJ

Dissection of insular cortex layer 5 reveals two sublayers with opposing modulatory roles in appetitive drinking behavior

iScience , 2023 May 26; 26(6):106985. Epub 2023 May 26

PubMed ID: 37378339 DOI: 10.1016/j.isci.2023.106985

Miller DS, Wright KM

Neuronal Dystroglycan regulates postnatal development of CCK/cannabinoid receptor-1 interneurons

Neural Dev , 2021 Aug 6; 16:4. Epub 2021 Aug 6

PubMed ID: 34362433 DOI: 10.1186/s13064-021-00153-1

Underwood R, Gannon M, Pathak A, Kapa N, Chandra S, Klop A, Yacoubian TA

14-3-3 mitigates alpha-synuclein aggregation and toxicity in the in vivo preformed fibril model

Acta Neuropathol Commun , 2021 Jan 7; 9:13. Epub 2021 Jan 7

PubMed ID: 33413679 DOI: 10.1186/s40478-020-01110-5

Miczán V, Kelemen K, Glavinics JR, László ZI, Barti B, Kenesei K, Kisfali M, Katona I

NECAB1 and NECAB2 are Prevalent Calcium-Binding Proteins of CB1/CCK-Positive GABAergic Interneurons

Cereb Cortex , 2020 Nov 24; 31(3):1786-1806. Epub 2020 Nov 24

PubMed ID: 33230531 DOI: 10.1093/cercor/bhaa326

Zhang MD, Tortoriello G, Hsueh B, Tomer R, Ye L, Mitsios N, Borgius L, Grant G, Kiehn O, Watanabe M, Uhlén M, Mulder J, Deisseroth K, Harkany T, Hökfelt TG

Neuronal calcium-binding proteins 1/2 localize to dorsal root ganglia and excitatory spinal neurons and are regulated by nerve injury

Proc Natl Acad Sci U S A , 2014 Mar 25; 111(12):E1149-E1158. Epub 2014 Mar 10

PubMed ID: 24616509 DOI: 10.1073/pnas.1402318111

Did we miss your publication?

Have you published using HPA023629? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch