Enhanced Validation

Anti-NDRG2 Antibody

NDRG family member 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human NDRG2
Alternative Gene Names
KIAA1248, SYLD
Price
$445.00
Product Number
HPA002896
Unit Size
100 µl
Concentration
Lot dependent
Availability
6 in Stock
Ships
Ready to Ship
Target Protein
NDRG family member 2
Target Gene
NDRG2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000010389 (94%)

Mouse ENSMUSG00000004558 (94%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
NDRG family member 2
Gene Name
NDRG2
Alternative Gene Names
KIAA1248, SYLD
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000165795 on the Human Protein Atlas

Mir BA, Islam R, Kalanon M, Russell AP, Foletta VC

MicroRNA suppression of stress-responsive NDRG2 during dexamethasone treatment in skeletal muscle cells

BMC Mol Cell Biol , 2019 May 28; 20:12. Epub 2019 May 28

PubMed ID: 31138100 DOI: 10.1186/s12860-019-0194-3

Kloten V, Schlensog M, Eschenbruch J, Gasthaus J, Tiedemann J, Mijnes J, Heide T, Braunschweig T, Knüchel R, Dahl E

Abundant NDRG2 Expression Is Associated with Aggressiveness and Unfavorable Patients’ Outcome in Basal-Like Breast Cancer

PLoS One , 2016 Jul 11; 11(7):e0159073. Epub 2016 Jul 11

PubMed ID: 27400234 DOI: 10.1371/journal.pone.0159073

Anderson KJ, Russell AP, Foletta VC

NDRG2 promotes myoblast proliferation and caspase 3/7 activities during differentiation, and attenuates hydrogen peroxide – But not palmitate-induced toxicity

FEBS Open Bio , 2015; 5:668-681. Epub 2015 Aug 7

PubMed ID: 26380811 DOI: 10.1016/j.fob.2015.08.001

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

Schilling SH, Hjelmeland AB, Radiloff DR, Liu IM, Wakeman TP, Fielhauer JR, Foster EH, Lathia JD, Rich JN, Wang XF, Datto MB

NDRG4 Is Required for Cell Cycle Progression and Survival in Glioblastoma Cells

J Biol Chem , 2009 Sep 11; 284(37):25160-25169. Epub 2009 Jul 10

PubMed ID: 19592488 DOI: 10.1074/jbc.M109.012484

Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M

Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics

Mol Cell Proteomics , 2009 Jul; 8(7):1612-1622. Epub 2009 Apr 7

PubMed ID: 19351664 DOI: 10.1074/mcp.M800539-MCP200

Tepel M, Roerig P, Wolter M, Gutmann DH, Perry A, Reifenberger G, Riemenschneider MJ

Frequent promoter hypermethylation and transcriptional downregulation of the NDRG2 gene at 14q11.2 in primary glioblastoma.

Int J Cancer , 2008 Nov 1; 123(9):2080-6

PubMed ID: 18709645 DOI: 10.1002/ijc.23705

Did we miss your publication?

Have you published using HPA002896? Please let us know and we will be happy to include your reference on this page.

Read more

User Data Western Blot, Customer Submission

Contribution from Marlena Rohm, Ruhr University Bochum — May 07, 2018

We have successfully tested the Anti-NDRG2 antibody (HPA002896) by Western blot in mouse spinal cord lysates.

 HPA002896_wb

Loaded Sample: Protein isolated out of spinal cord, 30 mg protein

Primary Antibody: Anti-NDRG2 antibody (HPA002896) 1:750 in TBS – over night, 4°C, shaking

Secondary Antibody: Anti-rabbit HRP 1:200 in TBS – 1h, room temp, shaking

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch