Enhanced Validation

Polyclonal Anti-NCF2 Antibody

neutrophil cytosolic factor 2
References (3)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human NCF2
Alternative Gene Names
NOXA2, p67phox
Open Datasheet
Price
$505.00
Product Number
HPA006040
Unit Size
100 µl
Concentration
Lot dependent
Availability
1 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human bone marrow and skeletal muscle tissues using HPA006040 antibody. Corresponding NCF2 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & cytosol.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
neutrophil cytosolic factor 2
Target Gene
NCF2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000026480 (92%)

Rat ENSRNOG00000009286 (39%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA006040 on the Human Protein Atlas
Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA006040 on the Human Protein Atlas
Protein Name
neutrophil cytosolic factor 2
Gene Name
NCF2
Alternative Gene Names
NOXA2, p67phox
UniProt ID
P19878
Gene (Ensembl)
ENSG00000116701
Entrez Gene ID
Entrez gene: 4688
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000116701 on the Human Protein Atlas

Månberg A, Bradley F, Qundos U, Guthrie BL, Birse K, Noël-Romas L, Lindskog C, Bosire R, Kiarie J, Farquhar C, Burgener AD, Nilsson P, Broliden K

A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection

Mol Cell Proteomics , 2019 Mar; 18(3):461-476

PubMed ID: 30504243 DOI: 10.1074/mcp.RA118.000757

Lomnytska MI, Becker S, Bodin I, Olsson A, Hellman K, Hellström AC, Mints M, Hellman U, Auer G, Andersson S

Differential expression of ANXA6, HSP27, PRDX2, NCF2, and TPM4 during uterine cervix carcinogenesis: diagnostic and prognostic value.

Br J Cancer , 2011 Jan 4; 104(1):110-9. Epub 2010 Nov 30

PubMed ID: 21119665 DOI: 10.1038/sj.bjc.6605992

Did we miss your publication?

Have you published using HPA006040? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-NCF2 (HPA002327)
Corresponding Antigens
PrEST Antigen NCF2 (APrEST78238)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch