Enhanced Validation

Anti-MYOF Antibody

myoferlin
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human MYOF
Alternative Gene Names
FER1L3, KIAA1207
Price
$445.00
Product Number
HPA014245
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
myoferlin
Target Gene
MYOF
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000048612 (86%)

Rat ENSRNOG00000016117 (82%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
myoferlin
Gene Name
MYOF
Alternative Gene Names
FER1L3, KIAA1207
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000138119 on the Human Protein Atlas

Rademaker G, Costanza B, Anania S, Agirman F, Maloujahmoum N, Di Valentin E, Goval JJ, Bellahcène A, Castronovo V, Peulen O

Myoferlin Contributes to the Metastatic Phenotype of Pancreatic Cancer Cells by Enhancing Their Migratory Capacity through the Control of Oxidative Phosphorylation

Cancers (Basel) , 2019 Jun 19; 11(6):853. Epub 2019 Jun 19

PubMed ID: 31248212 DOI: 10.3390/cancers11060853

Rademaker G, Hennequière V, Brohée L, Nokin MJ, Lovinfosse P, Durieux F, Gofflot S, Bellier J, Costanza B, Herfs M, Peiffer R, Bettendorff L, Deroanne C, Thiry M, Delvenne P, Hustinx R, Bellahcène A, Castronovo V, Peulen O

Myoferlin controls mitochondrial structure and activity in pancreatic ductal adenocarcinoma, and affects tumor aggressiveness

Oncogene , 2018 May 3; 37(32):4398-4412. Epub 2018 May 3

PubMed ID: 29720728 DOI: 10.1038/s41388-018-0287-z

Barnhouse VR, Weist JL, Shukla VC, Ghadiali SN, Kniss DA, Leight JL

Myoferlin regulates epithelial cancer cell plasticity and migration through autocrine TGF-β1 signaling

Oncotarget , 2018 Apr 10; 9(27):19209-19222. Epub 2018 Apr 10

PubMed ID: 29721195 DOI: 10.18632/oncotarget.24971

Yadav A, Kumar B, Lang JC, Teknos TN, Kumar P

A muscle specific protein “myoferlin” modulates IL-6/STAT3 signaling by chaperoning activated STAT3 to nucleus

Oncogene , 2017 Jul 24; 36(46):6374-6382. Epub 2017 Jul 24

PubMed ID: 28745314 DOI: 10.1038/onc.2017.245

Blomme A, Fahmy K, Peulen O, Costanza B, Fontaine M, Struman I, Baiwir D, de Pauw E, Thiry M, Bellahcène A, Castronovo V, Turtoi A

Myoferlin is a novel exosomal protein and functional regulator of cancer-derived exosomes

Oncotarget , 2016 Nov 10; 7(50):83669-83683. Epub 2016 Nov 10

PubMed ID: 27845903 DOI: 10.18632/oncotarget.13276

A Blomme, B Costanza, P de Tullio, M Thiry, G Van Simaeys, S Boutry, G Doumont, E Di Valentin, T Hirano, T Yokobori, S Gofflot, O Peulen, A Bellahcène, F Sherer, C Le Goff, E Cavalier, A Mouithys-Mickalad, F Jouret, P G Cusumano, E Lifrange, R N Muller, S Goldman, P Delvenne, E De Pauw, M Nishiyama, V Castronovo, A Turtoi

Myoferlin regulates cellular lipid metabolism and promotes metastases in triple-negative breast cancer

Oncogene , October 24, 2016

PubMed ID: None DOI: 10.1038/onc.2016.369

Bhattacharyya S, Rainey MA, Arya P, Dutta S, George M, Storck MD, McComb RD, Muirhead D, Todd GL, Gould K, Datta K, Waes JG, Band V, Band H

Endocytic recycling protein EHD1 regulates primary cilia morphogenesis and SHH signaling during neural tube development

Sci Rep , 2016 Feb 17; 6:20727. Epub 2016 Feb 17

PubMed ID: 26884322 DOI: 10.1038/srep20727

Volakis LI, Li R, Ackerman WE IV, Mihai C, Bechel M, Summerfield TL, Ahn CS, Powell HM, Zielinski R, Rosol TJ, Ghadiali SN, Kniss DA

Loss of Myoferlin Redirects Breast Cancer Cell Motility towards Collective Migration

PLoS One , 2014; 9(2):e86110. Epub 2014 Feb 26

PubMed ID: 24586247 DOI: 10.1371/journal.pone.0086110

Lindgren D, Boström AK, Nilsson K, Hansson J, Sjölund J, Möller C, Jirström K, Nilsson E, Landberg G, Axelson H, Johansson ME

Isolation and characterization of progenitor-like cells from human renal proximal tubules.

Am J Pathol , 2011 Feb; 178(2):828-37

PubMed ID: 21281815 DOI: 10.1016/j.ajpath.2010.10.026

Did we miss your publication?

Have you published using HPA014245? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch