Anti-MYO10 Antibody

myosin X
Recommended Applications
Product Description
Polyclonal Antibody against Human MYO10
Alternative Gene Names
KIAA0799
Price
$445.00
Product Number
HPA024223
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
myosin X
Target Gene
MYO10
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERSLSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000010161 (92%)

Mouse ENSMUSG00000022272 (91%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
myosin X
Gene Name
MYO10
Alternative Gene Names
KIAA0799
UniProt ID
Gene (Ensembl)
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000145555 on the Human Protein Atlas

Sun YY, Yang YF, Keller KE

Myosin-X Silencing in the Trabecular Meshwork Suggests a Role for Tunneling Nanotubes in Outflow Regulation

Invest Ophthalmol Vis Sci , 2019 Feb; 60(2):843-851

PubMed ID: 30807639 DOI: 10.1167/iovs.18-26055

Uhl J, Gujarathi S, Waheed AA, Gordon A, Freed EO, Gousset K

Myosin-X is essential to the intercellular spread of HIV-1 Nef through tunneling nanotubes

J Cell Commun Signal , 2018 Nov 15; 13(2):209-224. Epub 2018 Nov 15

PubMed ID: 30443895 DOI: 10.1007/s12079-018-0493-z

Robinson-McCarthy LR, McCarthy KR, Raaben M, Piccinotti S, Nieuwenhuis J, Stubbs SH, Bakkers MJ, Whelan SP

Reconstruction of the cell entry pathway of an extinct virus

PLoS Pathog , 2018 Aug 6; 14(8):e1007123. Epub 2018 Aug 6

PubMed ID: 30080900 DOI: 10.1371/journal.ppat.1007123

Tokuo H, Bhawan J, Coluccio LM

Myosin X is required for efficient melanoblast migration and melanoma initiation and metastasis

Sci Rep , 2018 Jul 11; 8:10449. Epub 2018 Jul 11

PubMed ID: 29993000 DOI: 10.1038/s41598-018-28717-y

Heimsath EG Jr, Yim YI, Mustapha M, Hammer JA, Cheney RE

Myosin-X knockout is semi-lethal and demonstrates that myosin-X functions in neural tube closure, pigmentation, hyaloid vasculature regression, and filopodia formation

Sci Rep , 2017 Dec 11; 7:17354. Epub 2017 Dec 11

PubMed ID: 29229982 DOI: 10.1038/s41598-017-17638-x

Tasca A, Astleford K, Lederman A, Jensen ED, Lee BS, Gopalakrishnan R, Mansky KC

Regulation of Osteoclast Differentiation by Myosin X

Sci Rep , 2017 Aug 8; 7:7603. Epub 2017 Aug 8

PubMed ID: 28790434 DOI: 10.1038/s41598-017-07855-9

Makowska KA, Hughes RE, White KJ, Wells CM, Peckham M

Specific Myosins Control Actin Organization, Cell Morphology, and Migration in Prostate Cancer Cells

Cell Rep , 2015 Dec 6; 13(10):2118-2125. Epub 2015 Dec 6

PubMed ID: 26670045 DOI: 10.1016/j.celrep.2015.11.012

Caltagarone J, Ma S, Sorkin A

Dopamine transporter is enriched in filopodia and induces filopodia formation

Mol Cell Neurosci , 2015 Apr 30; 68:120-130. Epub 2015 Apr 30

PubMed ID: 25936602 DOI: 10.1016/j.mcn.2015.04.005

Snyder JC, Rochelle LK, Marion S, Lyerly HK, Barak LS, Caron MG

Lgr4 and Lgr5 drive the formation of long actin-rich cytoneme-like membrane protrusions

J Cell Sci , 2015/03/15; 128(6):1230-1240

PubMed ID: 25653388 DOI: 10.1242/jcs.166322

Lin L, Sun W, Throesch B, Kung F, Decoster JT, Berner CJ, Cheney RE, Rudy B, Hoffman DA

DPP6 regulation of dendritic morphogenesis impacts hippocampal synaptic development

Nat Commun , 2013; 4:2270

PubMed ID: 23912628 DOI: 10.1038/ncomms3270

Lin WH, Hurley JT, Raines AN, Cheney RE, Webb DJ

Myosin X and its motorless isoform differentially modulate dendritic spine development by regulating trafficking and retention of vasodilator-stimulated phosphoprotein

J Cell Sci , 2013 Oct 15; 126(20):4756-4768

PubMed ID: 23943878 DOI: 10.1242/jcs.132969

Raines AN, Nagdas S, Kerber ML, Cheney RE

Headless Myo10 Is a Negative Regulator of Full-length Myo10 and Inhibits Axon Outgrowth in Cortical Neurons

J Biol Chem , 2012 Jul 20; 287(30):24873-24883. Epub 2012 May 31

PubMed ID: 22661706 DOI: 10.1074/jbc.M112.369173

Liu KC, Jacobs DT, Dunn BD, Fanning AS, Cheney RE

Myosin-X functions in polarized epithelial cells

Mol Biol Cell , 2012 May; 23(9):1675-1687

PubMed ID: 22419816 DOI: 10.1091/mbc.E11-04-0358

Did we miss your publication?

Have you published using HPA024223? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch