Enhanced Validation

Anti-MYH6 Antibody

myosin, heavy chain 6, cardiac muscle, alpha
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human MYH6
Price
$450.00
Product Number
HPA001349
Unit Size
Concentration
Lot dependent
Availability
5 in Stock
Ships
Ready to Ship
Target Protein
myosin, heavy chain 6, cardiac muscle, alpha
Target Gene
MYH6
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000040752 (97%)

Rat ENSRNOG00000025757 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
myosin, heavy chain 6, cardiac muscle, alpha
Gene Name
MYH6
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000197616 on the Human Protein Atlas

Zhang M, Haughey M, Wang NY, Blease K, Kapoun AM, Couto S, Belka I, Hoey T, Groza M, Hartke J, Bennett B, Cain J, Gurney A, Benish B, Castiglioni P, Drew C, Lachowicz J, Carayannopoulos L, Nathan SD, Distler J, Brenner DA, Hariharan K, Cho H, Xie W

Targeting the Wnt signaling pathway through R-spondin 3 identifies an anti-fibrosis treatment strategy for multiple organs

PLoS One , 2020 Mar 11; 15(3):e0229445. Epub 2020 Mar 11

PubMed ID: 32160239 DOI: 10.1371/journal.pone.0229445

Yuan C, Zhao X, Wang Z, Borg TK, Ye T, Khalpey ZI, Runyan RB, Shao Y, Gao BZ

Study of the Expression Transition of Cardiac Myosin Using Polarization-Dependent SHG Microscopy

Biophys J , 2020 Jan 3; 118(5):1058-1066. Epub 2020 Jan 3

PubMed ID: 31995740 DOI: 10.1016/j.bpj.2019.12.030

Schiaffino S, Murgia M, Leinwand LA, Reggiani C

Letter to the editor: Comments on Stuart et al. (2016): “Myosin content of individual human muscle fibers isolated by laser capture microdissection”

Am J Physiol Cell Physiol , 2016 Dec 1; 311(6):C1048-C1049

PubMed ID: 27956413 DOI: 10.1152/ajpcell.00294.2016

Stuart CA, Stone WL, Howell ME, Brannon MF, Hall HK, Gibson AL, Stone MH

Myosin content of individual human muscle fibers isolated by laser capture microdissection

Am J Physiol Cell Physiol , 2015 Dec 16; 310(5):C381-C389. Epub 2015 Dec 16

PubMed ID: 26676053 DOI: 10.1152/ajpcell.00317.2015

Tandon N, Marsano A, Maidhof R, Wan L, Park H, Vunjak-Novakovic G

Optimization of Electrical Stimulation Parameters for Cardiac Tissue Engineering

J Tissue Eng Regen Med , 2011 Jun; 5(6):e115-e125. Epub 2011 Jan 10

PubMed ID: 21604379 DOI: 10.1002/term.377

Kim KH, Kim TG, Micales BK, Lyons GE, Lee Y

Dynamic expression patterns of leucine-rich repeat containing protein 10 in the heart.

Dev Dyn , 2007 Aug; 236(8):2225-34

PubMed ID: 17626279 DOI: 10.1002/dvdy.21225

Did we miss your publication?

Have you published using HPA001349? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch