Enhanced Validation

Anti-MYH11 Antibody

myosin, heavy chain 11, smooth muscle
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human MYH11
Alternative Gene Names
SMHC, SMMHC
Price
$445.00
Product Number
HPA015310
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
myosin, heavy chain 11, smooth muscle
Target Gene
MYH11
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000057880 (95%)

Mouse ENSMUSG00000018830 (95%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
myosin, heavy chain 11, smooth muscle
Gene Name
MYH11
Alternative Gene Names
SMHC, SMMHC
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000133392 on the Human Protein Atlas

Dobie R, Wilson-Kanamori JR, Henderson BE, Smith JR, Matchett KP, Portman JR, Wallenborg K, Picelli S, Zagorska A, Pendem SV, Hudson TE, Wu MM, Budas GR, Breckenridge DG, Harrison EM, Mole DJ, Wigmore SJ, Ramachandran P, Ponting CP, Teichmann SA, Marioni JC, Henderson NC

Single-Cell Transcriptomics Uncovers Zonation of Function in the Mesenchyme during Liver Fibrosis

Cell Rep , 2019 Nov 12; 29(7):1832-1847.e8. Epub 2019 Nov 12

PubMed ID: 31722201 DOI: 10.1016/j.celrep.2019.10.024

Foo KS, Lehtinen ML, Leung CY, Lian X, Xu J, Keung W, Geng L, Kolstad TR, Thams S, Wong AO, Wong N, Bylund K, Zhou C, He X, Jin SB, Clarke J, Lendahl U, Li RA, Louch WE, Chien KR

Human ISL1+ Ventricular Progenitors Self-Assemble into an In Vivo Functional Heart Patch and Preserve Cardiac Function Post Infarction

Mol Ther , 2018 Feb 17; 26(7):1644-1659. Epub 2018 Feb 17

PubMed ID: 29606507 DOI: 10.1016/j.ymthe.2018.02.012

Did we miss your publication?

Have you published using HPA015310? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch