Enhanced Validation

Anti-MUC5B Antibody

mucin 5B, oligomeric mucus/gel-forming
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human MUC5B
Alternative Gene Names
MG1, MUC5
Price
$437.00
Product Number
HPA008246
Unit Size
100 µl
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target protein
mucin 5B, oligomeric mucus/gel-forming
Target gene
MUC5B
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000019846 (64%)

Mouse ENSMUSG00000066108 (64%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
mucin 5B, oligomeric mucus/gel-forming
Gene Name
MUC5B
Alternative Gene Names
MG1, MUC5
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000117983 on the Human Protein Atlas

Gry M, Oksvold P, Pontén F, Uhlén M

Tissue specific protein expression in human cells, tissues and organs

J Proteomics Bioinform , September 24, 2010; 3:286- 293

PubMed ID: 0 DOI: 10.4172/jpb.1000153

Wang G, Lou HH, Salit J, Leopold PL, Driscoll S, Schymeinsky J, Quast K, Visvanathan S, Fine JS, Thomas MJ, Crystal RG

Characterization of an immortalized human small airway basal stem/progenitor cell line with airway region-specific differentiation capacity

Respir Res , 2019 Aug 23; 20:196. Epub 2019 Aug 23

PubMed ID: 31443657 DOI: 10.1186/s12931-019-1140-9

Rayner RE, Makena P, Prasad GL, Cormet-Boyaka E

Optimization of Normal Human Bronchial Epithelial (NHBE) Cell 3D Cultures for in vitro Lung Model Studies

Sci Rep , 2019 Jan 24; 9:500. Epub 2019 Jan 24

PubMed ID: 30679531 DOI: 10.1038/s41598-018-36735-z

Hynds RE, Ben Aissa A, Gowers KH, Watkins TB, Bosshard‐Carter L, Rowan AJ, Veeriah S, Wilson GA, Quezada SA, Swanton C, on behalf of the TRACERx Consortium, Janes SM

Expansion of airway basal epithelial cells from primary human non‐small cell lung cancer tumors

Int J Cancer , 2018 Apr 6; 143(1):160-166. Epub 2018 Apr 6

PubMed ID: 29569246 DOI: 10.1002/ijc.31383

Crowley C, Klanrit P, Butler CR, Varanou A, Platé M, Hynds RE, Chambers RC, Seifalian AM, Birchall MA, Janes SM

Surface modification of a POSS-nanocomposite material to enhance cellular integration of a synthetic bioscaffold

Biomaterials , 2016/03/01; 83:283-293

PubMed ID: 26790147 DOI: 10.1016/j.biomaterials.2016.01.005

Meyerholz DK, Stoltz DA, Namati E, Ramachandran S, Pezzulo AA, Smith AR, Rector MV, Suter MJ, Kao S, McLennan G, Tearney GJ, Zabner J, McCray PB Jr, Welsh MJ

Loss of Cystic Fibrosis Transmembrane Conductance Regulator Function Produces Abnormalities in Tracheal Development in Neonatal Pigs and Young Children

Am J Respir Crit Care Med , 2010 Nov 15; 182(10):1251-1261. Epub 2010 Jul 9

PubMed ID: 20622026 DOI: 10.1164/rccm.201004-0643OC

Did we miss your publication?

Have you published using HPA008246? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch