Enhanced Validation

Polyclonal Anti-MST1R Antibody

macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
References (2)
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human MST1R
Alternative Gene Names
CD136, CDw136, PTK8, RON
Open Datasheet
Price
$505.00
Product Number
HPA007657
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemical staining of human cerebral cortex, gastrointestinal, lymph node and skin using Anti-MST1R antibody HPA007657 (A) shows similar protein distribution across tissues to independent antibody HPA008180 (B).

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
Target Gene
MST1R
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSF
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000032584 (74%)

Rat ENSRNOG00000032618 (67%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
View all protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-MST1R HPA008180.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA007657 on the Human Protein Atlas
Protein Name
macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
Gene Name
MST1R
Alternative Gene Names
CD136, CDw136, PTK8, RON
UniProt ID
Q04912
Gene (Ensembl)
ENSG00000164078
Entrez Gene ID
Entrez gene: 4486
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000164078 on the Human Protein Atlas

Berning P, Hennemann C, Tulotta C, Schaefer C, Lechtape B, Hotfilder M, El Gourari Y, Jürgens H, Snaar-Jagalska E, Hempel G, Dirksen U, Potratz J

The Receptor Tyrosine Kinase RON and Its Isoforms as Therapeutic Targets in Ewing Sarcoma

Cancers (Basel) , 2020 Apr 7; 12(4):904. Epub 2020 Apr 7

PubMed ID: 32272784 DOI: 10.3390/cancers12040904

Did we miss your publication?

Have you published using HPA007657? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-MST1R (AMAb90766)
Anti-MST1R (HPA008180)
Corresponding Antigens
PrEST Antigen MST1R (APrEST71446)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch