Anti-MSL2 Antibody

male-specific lethal 2 homolog (Drosophila)
Recommended Applications
Product Description
Polyclonal Antibody against Human MSL2
Alternative Gene Names
FLJ10546, KIAA1585, msl-2, MSL2L1, RNF184
Price
$437.00
Product Number
HPA003413
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
male-specific lethal 2 homolog (Drosophila)
Target gene
MSL2
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SPEHSNTIDVCNTVDIKTEDLSDSLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETVSNTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKIAKLNRKRSRSESDSEKVQ
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000023021 (98%)

Mouse ENSMUSG00000066415 (98%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Protocols
Protein Name
male-specific lethal 2 homolog (Drosophila)
Gene Name
MSL2
Alternative Gene Names
FLJ10546, KIAA1585, msl-2, MSL2L1, RNF184
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000174579 on the Human Protein Atlas

Valsecchi CI, Basilicata MF, Semplicio G, Georgiev P, Gutierrez NM, Akhtar A

Facultative dosage compensation of developmental genes on autosomes in Drosophila and mouse embryonic stem cells

Nat Commun , 2018 Sep 7; 9:3626. Epub 2018 Sep 7

PubMed ID: 30194291 DOI: 10.1038/s41467-018-05642-2

Tuğçe Aktaş, İbrahim Avşar Ilık, Daniel Maticzka, Vivek Bhardwaj, Cecilia Pessoa Rodrigues, Gerhard Mittler, Thomas Manke, Rolf Backofen, Asifa Akhtar

DHX9 suppresses RNA processing defects originating from the Alu invasion of the human genome

Nature , 544, 115-119 (2017)

DOI: 10.1038/nature21715

Sarantis Chlamydas, Herbert Holz, Maria Samata, Tomasz Chelmicki, Plamen Georgiev, Vicent Pelechano, Friederike Dündar, Pouria Dasmeh, Gerhard Mittler, Filipe Tavares Cadete, Fidel Ramírez, Thomas Conrad, Wu Wei, Sunil Raja, Thomas Manke, Nicholas M Luscombe, Lars M Steinmetz, Asifa Akhtar

Functional interplay between MSL1 and CDK7 controls RNA polymerase II Ser5 phosphorylation

Nature Structural & Molecular Biology , May 16, 2016

DOI: 10.1038/nsmb.3233

Chelmicki T, Dündar F, Turley MJ, Khanam T, Aktas T, Ramírez F, Gendrel AV, Wright PR, Videm P, Backofen R, Heard E, Manke T, Akhtar A

MOF-associated complexes ensure stem cell identity and Xist repression

eLife , 2014 May 19; 3:e02024. Epub 2014 May 19

PubMed ID: 24842875 DOI: 10.7554/eLife.02024

Did we miss your publication?

Have you published using HPA003413? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens