Enhanced Validation

Anti-MRC1 Antibody

mannose receptor, C type 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human MRC1
Alternative Gene Names
bA541I19.1, CD206, CLEC13D, CLEC13DL, MRC1L1
Price
$437.00
Product Number
HPA004114
Unit Size
100 µl
Concentration
Lot dependent
Availability
9 in Stock
Ships
Ready to Ship
Target protein
mannose receptor, C type 1
Target gene
MRC1
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000018251 (86%)

Mouse ENSMUSG00000026712 (84%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-MRC1 HPA045134.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
mannose receptor, C type 1
Gene Name
MRC1
Alternative Gene Names
bA541I19.1, CD206, CLEC13D, CLEC13DL, MRC1L1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000260314 on the Human Protein Atlas

Liu L, Wei Q, Lin Q, Fang J, Wang H, Kwok H, Tang H, Nishiura K, Peng J, Tan Z, Wu T, Cheung KW, Chan KH, Alvarez X, Qin C, Lackner A, Perlman S, Yuen KY, Chen Z

Anti–spike IgG causes severe acute lung injury by skewing macrophage responses during acute SARS-CoV infection

JCI Insight , 2019 Feb 21; 4(4):e123158. Epub 2019 Feb 21

PubMed ID: 30830861 DOI: 10.1172/jci.insight.123158

Pincus SH, Bhaskaran M, Brey RN III, Didier PJ, Doyle-Meyers LA, Roy CJ

Clinical and Pathological Findings Associated with Aerosol Exposure of Macaques to Ricin Toxin

Toxins (Basel) , 2015 Jun 9; 7(6):2121-2133. Epub 2015 Jun 9

PubMed ID: 26067369 DOI: 10.3390/toxins7062121

Cai Y, Sugimoto C, Arainga M, Alvarez-Hernandez X, Didier ES, Kuroda MJ

In vivo characterization of alveolar and interstitial lung macrophages in rhesus macaques: Implications for understanding lung disease in humans

J Immunol , 2014 Mar 15; 192(6):2821-2829. Epub 2014 Feb 17

PubMed ID: 24534529 DOI: 10.4049/jimmunol.1302269

Eirin A, Zhang X, Zhu XY, Tang H, Jordan KL, Grande JP, Dietz AB, Lerman A, Textor SC, Lerman LO

Renal vein cytokine release as an index of renal parenchymal inflammation in chronic experimental renal artery stenosis

Nephrol Dial Transplant , 2014 Feb; 29(2):274-282. Epub 2013 Oct 3

PubMed ID: 24097799 DOI: 10.1093/ndt/gft305

Eirin A, Williams BJ, Ebrahimi B, Zhang X, Crane JA, Lerman A, Textor SC, Lerman LO

Mitochondrial targeted peptides attenuate residual myocardial damage after reversal of experimental renovascular hypertension

J Hypertens , 2014 Jan; 32(1):154-165

PubMed ID: 24048008 DOI: 10.1097/HJH.0b013e3283658a53

Did we miss your publication?

Have you published using HPA004114? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch