Enhanced Validation

Polyclonal Anti-MMP9 Antibody

matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human MMP9
Alternative Gene Names
CLG4B
Price
$459.00
Product Number
HPA001238
Unit Size
Concentration
Lot dependent
Availability
5 in Stock
Ships
Ready to Ship
Target Protein
matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Target Gene
MMP9
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000017539 (80%)

Mouse ENSMUSG00000017737 (78%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Gene Name
MMP9
Alternative Gene Names
CLG4B
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000100985 on the Human Protein Atlas

Boonsongserm P, Angsuwatcharakon P, Puttipanyalears C, Aporntewan C, Kongruttanachok N, Aksornkitti V, Kitkumthorn N, Mutirangura A

Tumor-induced DNA methylation in the white blood cells of patients with colorectal cancer

Oncol Lett , 2019 Jul 18; 18(3):3039-3048. Epub 2019 Jul 18

PubMed ID: 31452782 DOI: 10.3892/ol.2019.10638

Månberg A, Bradley F, Qundos U, Guthrie BL, Birse K, Noël-Romas L, Lindskog C, Bosire R, Kiarie J, Farquhar C, Burgener AD, Nilsson P, Broliden K

A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection

Mol Cell Proteomics , 2019 Mar; 18(3):461-476

PubMed ID: 30504243 DOI: 10.1074/mcp.RA118.000757

Gouravan S, Meza-Zepeda LA, Myklebost O, Stratford EW, Munthe E

Preclinical Evaluation of Vemurafenib as Therapy for BRAFV600E Mutated Sarcomas

Int J Mol Sci , 2018 Mar 23; 19(4):969. Epub 2018 Mar 23

PubMed ID: 29570692 DOI: 10.3390/ijms19040969

Wang G, Liu J, Cai Y, Chen J, Xie W, Kong X, Huang W, Guo H, Zhao X, Lu Y, Niu L, Li X, Zhang H, Lei C, Lei Z, Yin J, Hu H, Yu F, Nie Y, Xia L, Wu K

Loss of Barx1 promotes hepatocellular carcinoma metastasis through up-regulating MGAT5 and MMP9 expression and indicates poor prognosis

Oncotarget , 2017 May 30; 8(42):71867-71880. Epub 2017 May 30

PubMed ID: 29069753 DOI: 10.18632/oncotarget.18288

Zeng LR, Zhu FB, Wang JY, Hou Q, Yue ZS, Yan SG, Quan RF, Zhang YL

Local influence of high molecular polyethylene particles on heterotopic ossification

Exp Ther Med , 2017 Apr 12; 13(6):2934-2938. Epub 2017 Apr 12

PubMed ID: 28587363 DOI: 10.3892/etm.2017.4327

Yang R, Zhang Y, Huang D, Luo X, Zhang L, Zhu X, Zhang X, Liu Z, Han JY, Xiong JW

Miconazole protects blood vessels from MMP9-dependent rupture and hemorrhage

Dis Model Mech , 2017 Mar 1; 10(3):337-348

PubMed ID: 28153846 DOI: 10.1242/dmm.027268

Dong P, Xiong Y, Watari H, Hanley SJ, Konno Y, Ihira K, Suzuki F, Yamada T, Kudo M, Yue J, Sakuragi N

Suppression of iASPP-dependent aggressiveness in cervical cancer through reversal of methylation silencing of microRNA-124

Sci Rep , 2016 Oct 21; 6:35480. Epub 2016 Oct 21

PubMed ID: 27765948 DOI: 10.1038/srep35480

Bass JA, Friesen CA, Deacy AD, Neilan NA, Bracken JM, Shakhnovich V, Singh V

Investigation of potential early Histologic markers of pediatric inflammatory bowel disease

BMC Gastroenterol , 2015 Oct 13; 15:129. Epub 2015 Oct 13

PubMed ID: 26463759 DOI: 10.1186/s12876-015-0359-2

Song C, Zhu S, Wu C, Kang J

Histone Deacetylase (HDAC) 10 Suppresses Cervical Cancer Metastasis through Inhibition of Matrix Metalloproteinase (MMP) 2 and 9 Expression

J Biol Chem , 2013 Sep 27; 288(39):28021-28033. Epub 2013 Jul 29

PubMed ID: 23897811 DOI: 10.1074/jbc.M113.498758

Did we miss your publication?

Have you published using HPA001238? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch