Polyclonal Anti-MKI67 Antibody

marker of proliferation Ki-67
References (10)
Recommended Applications
Product Description
Polyclonal Antibody against Human MKI67
Alternative Gene Names
MIB-, PPP1R105
Open Datasheet
Price
$505.00
Product Number
HPA001164
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & nuclear bodies.

Additional Images

See additional ICC images using this antibody on the Human Protein Atlas
Target Protein
marker of proliferation Ki-67
Target Gene
MKI67
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQSGRKSTEFPRKIREQEPARRVSRSSFSSDPDEKAQDSKAYSKITEGKVSGNPQVHI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000031004 (68%)

Rat ENSRNOG00000028137 (68%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA001164 on the Human Protein Atlas
Protein Name
marker of proliferation Ki-67
Gene Name
MKI67
Alternative Gene Names
MIB-, PPP1R105
UniProt ID
P46013
Gene (Ensembl)
ENSG00000148773
Entrez Gene ID
Entrez gene: 4288
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000148773 on the Human Protein Atlas

Vallino L, Garavaglia B, Visciglia A, Amoruso A, Pane M, Ferraresi A, Isidoro C

Cell-free Lactiplantibacillus plantarum OC01 supernatant suppresses IL-6-induced proliferation and invasion of human colorectal cancer cells: Effect on β-Catenin degradation and induction of autophagy

J Tradit Complement Med , 2023 Feb 21; 13(2):193-206. Epub 2023 Feb 21

PubMed ID: 36970462 DOI: 10.1016/j.jtcme.2023.02.001

van Schaik T, Manzo SG, Vouzas AE, Liu NQ, Teunissen H, de Wit E, Gilbert DM, van Steensel B

Dynamic chromosomal interactions and control of heterochromatin positioning by Ki‐67

EMBO Rep , 2022 Oct 17; 23(12):e55782. Epub 2022 Oct 17

PubMed ID: 36245428 DOI: 10.15252/embr.202255782

Garavaglia B, Vallino L, Ferraresi A, Esposito A, Salwa A, Vidoni C, Gentilli S, Isidoro C

Butyrate Inhibits Colorectal Cancer Cell Proliferation through Autophagy Degradation of β-Catenin Regardless of APC and β-Catenin Mutational Status

Biomedicines , 2022 May 13; 10(5):1131. Epub 2022 May 13

PubMed ID: 35625868 DOI: 10.3390/biomedicines10051131

Secomandi E, Salwa A, Vidoni C, Ferraresi A, Follo C, Isidoro C

High Expression of the Lysosomal Protease Cathepsin D Confers Better Prognosis in Neuroblastoma Patients by Contrasting EGF-Induced Neuroblastoma Cell Growth

Int J Mol Sci , 2022 Apr 26; 23(9):4782. Epub 2022 Apr 26

PubMed ID: 35563171 DOI: 10.3390/ijms23094782

Esposito A, Ferraresi A, Salwa A, Vidoni C, Dhanasekaran DN, Isidoro C

Resveratrol Contrasts IL-6 Pro-Growth Effects and Promotes Autophagy-Mediated Cancer Cell Dormancy in 3D Ovarian Cancer: Role of miR-1305 and of Its Target ARH-I

Cancers (Basel) , 2022 Apr 25; 14(9):2142. Epub 2022 Apr 25

PubMed ID: 35565270 DOI: 10.3390/cancers14092142

Geread RS, Sivanandarajah A, Brouwer ER, Wood GA, Androutsos D, Faragalla H, Khademi A

piNET–An Automated Proliferation Index Calculator Framework for Ki67 Breast Cancer Images

Cancers (Basel) , 2020 Dec 22; 13(1):11. Epub 2020 Dec 22

PubMed ID: 33375043 DOI: 10.3390/cancers13010011

Mangosh TL, Awadallah WN, Grabowska MM, Taylor DJ

SLX4IP Promotes Telomere Maintenance in Androgen Receptor–Independent Castration-Resistant Prostate Cancer through ALT-like Telomeric PML Localization

Mol Cancer Res , 2020 Nov 13; 19(2):301-316. Epub 2020 Nov 13

PubMed ID: 33188147 DOI: 10.1158/1541-7786.MCR-20-0314

Dusart P, Fagerberg L, Perisic L, Civelek M, Struck E, Hedin U, Uhlén M, Trégouët DA, Renné T, Odeberg J, Butler LM

A systems-approach reveals human nestin is an endothelial-enriched, angiogenesis-independent intermediate filament protein

Sci Rep , 2018 Oct 2; 8:14668. Epub 2018 Oct 2

PubMed ID: 30279450 DOI: 10.1038/s41598-018-32859-4

Roca H, Craig MJ, Ying C, Varsos ZS, Czarnieski P, Alva AS, Hernandez J, Fuller D, Daignault S, Healy PN, Pienta KJ

IL-4 induces proliferation in prostate cancer PC3 cells under nutrient-depletion stress through the activation of the JNK-pathway and survivin upregulation

J Cell Biochem , 2012 May; 113(5):1569-1580

PubMed ID: 22174091 DOI: 10.1002/jcb.24025

Did we miss your publication?

Have you published using HPA001164? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-MKI67 (AMAb90870)
Anti-MKI67 (HPA000451)
Corresponding Antigens
PrEST Antigen MKI67 (APrEST79721)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch