Polyclonal Anti-MFF Antibody

mitochondrial fission factor
Recommended Applications
Product Description
Polyclonal Antibody against Human MFF
Alternative Gene Names
C2orf33, GL004
Price
$459.00
Product Number
HPA010968
Unit Size
Concentration
Lot dependent
Availability
7 in Stock
Ships
Ready to Ship
Target Protein
mitochondrial fission factor
Target Gene
MFF
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RFQAPISAPEYTVTPSPQQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKR
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000026150 (94%)

Rat ENSRNOG00000048016 (83%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Protein Name
mitochondrial fission factor
Gene Name
MFF
Alternative Gene Names
C2orf33, GL004
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000168958 on the Human Protein Atlas

Helle SC, Feng Q, Aebersold MJ, Hirt L, Grüter RR, Vahid A, Sirianni A, Mostowy S, Snedeker JG, Šarić A, Idema T, Zambelli T, Kornmann B

Mechanical force induces mitochondrial fission

eLife , 2017 Nov 9; 6:e30292. Epub 2017 Nov 9

PubMed ID: 29119945 DOI: 10.7554/eLife.30292

Cho B, Cho HM, Kim HJ, Jeong J, Park SK, Hwang EM, Park JY, Kim WR, Kim H, Sun W

CDK5-dependent inhibitory phosphorylation of Drp1 during neuronal maturation

Exp Mol Med , 2014 Jul 11; 46(7):e105-. Epub 2014 Jul 11

PubMed ID: 25012575 DOI: 10.1038/emm.2014.36

Li H, Alavian KN, Lazrove E, Mehta N, Jones A, Zhang P, Licznerski P, Graham M, Uo T, Guo J, Rahner C, Duman RS, Morrison RS, Jonas EA

A Bcl-xL-Drp1 complex regulates synaptic vesicle membrane dynamics during endocytosis

Nat Cell Biol , 2013 Jul; 15(7):773-785. Epub 2013 Jun 23

PubMed ID: 23792689 DOI: 10.1038/ncb2791

Did we miss your publication?

Have you published using HPA010968? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch