1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-METTL14

Anti-METTL14 Antibody

methyltransferase like 14
References (27)
Recommended Applications
Product Description
Polyclonal Antibody against Human METTL14
Alternative Gene Names
KIAA1627
Open Datasheet
Price
$450.00
Product Number
HPA038002
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[3 pictures]
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
methyltransferase like 14
Target Gene
METTL14
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000015250 (92%)

Mouse ENSMUSG00000028114 (92%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Protein Name
methyltransferase like 14
Gene Name
METTL14
Alternative Gene Names
KIAA1627
UniProt ID
Q9HCE5
Gene (Ensembl)
ENSG00000145388
Entrez Gene ID
Entrez gene: 57721
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000145388 on the Human Protein Atlas

Jabs S, Biton A, Bécavin C, Nahori MA, Ghozlane A, Pagliuso A, Spanò G, Guérineau V, Touboul D, Giai Gianetto Q, Chaze T, Matondo M, Dillies MA, Cossart P

Impact of the gut microbiota on the m6A epitranscriptome of mouse cecum and liver

Nat Commun , 2020 Mar 12; 11:1344. Epub 2020 Mar 12

PubMed ID: 32165618 DOI: 10.1038/s41467-020-15126-x

Mao Y, Dong L, Liu XM, Guo J, Ma H, Shen B, Qian SB

m6A in mRNA coding regions promotes translation via the RNA helicase-containing YTHDC2

Nat Commun , 2019 Nov 25; 10:5332. Epub 2019 Nov 25

PubMed ID: 31767846 DOI: 10.1038/s41467-019-13317-9

De Jesus DF, Zhang Z, Kahraman S, Brown NK, Chen M, Hu J, Gupta MK, He C, Kulkarni RN

m6A mRNA Methylation Regulates Human β-Cell Biology in Physiological States and in Type 2 Diabetes

Nat Metab , 2019 Jul 29; 1(8):765-774. Epub 2019 Jul 29

PubMed ID: 31867565 DOI: 10.1038/s42255-019-0089-9

Chen J, Zhang YC, Huang C, Shen H, Sun B, Cheng X, Zhang YJ, Yang YG, Shu Q, Yang Y, Li X

m6A Regulates Neurogenesis and Neuronal Development by Modulating Histone Methyltransferase Ezh2

Genomics Proteomics Bioinformatics , 2019 May 30; 17(2):154-168. Epub 2019 May 30

PubMed ID: 31154015 DOI: 10.1016/j.gpb.2018.12.007

Wang H, Hu X, Huang M, Liu J, Gu Y, Ma L, Zhou Q, Cao X

Mettl3-mediated mRNA m6A methylation promotes dendritic cell activation

Nat Commun , 2019 Apr 23; 10:1898. Epub 2019 Apr 23

PubMed ID: 31015515 DOI: 10.1038/s41467-019-09903-6

Song H, Feng X, Zhang H, Luo Y, Huang J, Lin M, Jin J, Ding X, Wu S, Huang H, Yu T, Zhang M, Hong H, Yao S, Zhao Y, Zhang Z

METTL3 and ALKBH5 oppositely regulate m6A modification of TFEB mRNA, which dictates the fate of hypoxia/reoxygenation-treated cardiomyocytes

Autophagy , 2019 Mar 17; 15(8):1419-1437. Epub 2019 Mar 17

PubMed ID: 30870073 DOI: 10.1080/15548627.2019.1586246

Panneerdoss S, Eedunuri VK, Yadav P, Timilsina S, Rajamanickam S, Viswanadhapalli S, Abdelfattah N, Onyeagucha BC, Cui X, Lai Z, Mohammad TA, Gupta YK, Huang TH, Huang Y, Chen Y, Rao MK

Cross-talk among writers, readers, and erasers of m6A regulates cancer growth and progression

Sci Adv , 2018 Oct 3; 4(10):eaar8263. Epub 2018 Oct 3

PubMed ID: 30306128 DOI: 10.1126/sciadv.aar8263

Lesbirel S, Viphakone N, Parker M, Parker J, Heath C, Sudbery I, Wilson SA

The m6A-methylase complex recruits TREX and regulates mRNA export

Sci Rep , 2018 Sep 14; 8:13827. Epub 2018 Sep 14

PubMed ID: 30218090 DOI: 10.1038/s41598-018-32310-8

Zhang F, Kang Y, Wang M, Li Y, Xu T, Yang W, Song H, Wu H, Shu Q, Jin P

Fragile X mental retardation protein modulates the stability of its m6A-marked messenger RNA targets

Hum Mol Genet , 2018 Aug 9; 27(22):3936-3950. Epub 2018 Aug 9

PubMed ID: 30107516 DOI: 10.1093/hmg/ddy292

Sorci M, Ianniello Z, Cruciani S, Larivera S, Ginistrelli LC, Capuano E, Marchioni M, Fazi F, Fatica A

METTL3 regulates WTAP protein homeostasis

Cell Death Dis , 2018 Jul 23; 9(8):796. Epub 2018 Jul 23

PubMed ID: 30038300 DOI: 10.1038/s41419-018-0843-z

Wang CX, Cui GS, Liu X, Xu K, Wang M, Zhang XX, Jiang LY, Li A, Yang Y, Lai WY, Sun BF, Jiang GB, Wang HL, Tong WM, Li W, Wang XJ, Yang YG, Zhou Q

METTL3-mediated m6A modification is required for cerebellar development

PLoS Biol , 2018 Jun 7; 16(6):e2004880. Epub 2018 Jun 7

PubMed ID: 29879109 DOI: 10.1371/journal.pbio.2004880

Koranda JL, Dore L, Shi H, Patel MJ, Vaasjo LO, Rao MN, Chen K, Lu Z, Yi Y, Chi W, He C, Zhuang X

Mettl14 is essential for epitranscriptomic regulation of striatal function and learning

Neuron , 2018 Jun 28; 99(2):283-292.e5. Epub 2018 Jun 28

PubMed ID: 30056831 DOI: 10.1016/j.neuron.2018.06.007

Zhou J, Wan J, Shu XE, Mao Y, Liu XM, Yuan X, Zhang X, Hess ME, Brüning JC, Qian SB

N6-Methyladenosine Guides mRNA Alternative Translation during Integrated Stress Response

Mol Cell , 2018 Feb 8; 69(4):636-647.e7. Epub 2018 Feb 8

PubMed ID: 29429926 DOI: 10.1016/j.molcel.2018.01.019

Wang Y, Li Y, Yue M, Wang J, Kumar S, Wechsler-Reya RJ, Zhang Z, Ogawa Y, Kellis M, Duester G, Zhao JC

N6-methyladenosine RNA modification regulates embryonic neural stem cell self-renewal through histone modifications

Nat Neurosci , 2018 Jan 15; 21(2):195-206. Epub 2018 Jan 15

PubMed ID: 29335608 DOI: 10.1038/s41593-017-0057-1

Weng H, Huang H, Wu H, Qin X, Zhao BS, Dong L, Shi H, Skibbe J, Shen C, Hu C, Sheng Y, Wang Y, Wunderlich M, Zhang B, Dore LC, Su R, Deng X, Ferchen K, Li C, Sun M, Lu Z, Jiang X, Marcucci G, Mulloy J, Yang J, Qian Z, Wei M, He C, Chen J

METTL14 Inhibits Hematopoietic Stem/Progenitor Differentiation and Promotes Leukemogenesis via mRNA m6A Modification

Cell Stem Cell , 2017 Dec 28; 22(2):191-205.e9. Epub 2017 Dec 28

PubMed ID: 29290617 DOI: 10.1016/j.stem.2017.11.016

Yu J, Chen M, Huang H, Zhu J, Song H, Zhu J, Park J, Ji SJ

Dynamic m6A modification regulates local translation of mRNA in axons

Nucleic Acids Res , 2017 Nov 23; 46(3):1412-1423. Epub 2017 Nov 23

PubMed ID: 29186567 DOI: 10.1093/nar/gkx1182

Ly P Vu, Brian F Pickering, Yuanming Cheng, Sara Zaccara, Diu Nguyen, Gerard Minuesa, Timothy Chou, Arthur Chow, Yogesh Saletore, Matthew MacKay, Jessica Schulman, Christopher Famulare, Minal Patel, Virginia M Klimek, Francine E Garrett-Bakelman, Ari Melnick, Martin Carroll, Christopher E Mason, Samie R Jaffrey, Michael G Kharas

The N6-methyladenosine (m6A)-forming enzyme METTL3 controls myeloid differentiation of normal hematopoietic and leukemia cells

Nature Medicine , September 18, 2017

PubMed ID: None DOI: 10.1038/nm.4416

Chang M, Lv H, Zhang W, Ma C, He X, Zhao S, Zhang ZW, Zeng YX, Song S, Niu Y, Tong WM

Region-specific RNA m6A methylation represents a new layer of control in the gene regulatory network in the mouse brain

Open Biol , 2017 Sep 20; 7(9):170166. Epub 2017 Sep 20

PubMed ID: 28931651 DOI: 10.1098/rsob.170166

Herzog VA, Reichholf B, Neumann T, Rescheneder P, Bhat P, Burkard TR, Wlotzka W, von Haeseler A, Zuber J, Ameres SL

Thiol-linked alkylation of RNA to assess expression dynamics

Nat Methods , 2017 Sep 25; 14(12):1198-1204. Epub 2017 Sep 25

PubMed ID: 28945705 DOI: 10.1038/nmeth.4435

Liu N, Zhou KI, Parisien M, Dai Q, Diatchenko L, Pan T

N 6-methyladenosine alters RNA structure to regulate binding of a low-complexity protein

Nucleic Acids Res , 2017 Feb 25; 45(10):6051-6063. Epub 2017 Feb 25

PubMed ID: 28334903 DOI: 10.1093/nar/gkx141

Tirumuru N, Zhao BS, Lu W, Lu Z, He C, Wu L

N6-methyladenosine of HIV-1 RNA regulates viral infection and HIV-1 Gag protein expression

eLife , 2016 Jul 2; 5:e15528. Epub 2016 Jul 2

PubMed ID: 27371828 DOI: 10.7554/eLife.15528

Lin S, Choe J, Du P, Triboulet R, Gregory RI

METTL3 promotes translation in human cancer cells

Mol Cell , 2016 Apr 21; 62(3):335-345. Epub 2016 Apr 21

PubMed ID: 27117702 DOI: 10.1016/j.molcel.2016.03.021

Zhou J, Wan J, Gao X, Zhang X, Qian SB

Dynamic m6A mRNA methylation directs translational control of heat shock response

Nature , 2015/10/22; 526(7574):591-594. Epub 2015 Oct 12

PubMed ID: 26458103 DOI: 10.1038/nature15377

Liu N, Dai Q, Zheng G, He C, Parisien M, Pan T

N6-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions

Nature , 2015 Feb 26; 518(7540):560-564

PubMed ID: 25719671 DOI: 10.1038/nature14234

Wang Y, Li Y, Toth JI, Petroski MD, Zhang Z, Zhao JC

N6-methyladenosine modification destabilizes developmental regulators in embryonic stem cells.

Nat Cell Biol , 2014 Feb; 16(2):191-8. Epub 2014 Jan 7

PubMed ID: 24394384 DOI: 10.1038/ncb2902

Liu J, Yue Y, Han D, Wang X, Fu Y, Zhang L, Jia G, Yu M, Lu Z, Deng X, Dai Q, Chen W, He C

A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation

Nat Chem Biol , 2014 Feb; 10(2):93-95. Epub 2013 Dec 6

PubMed ID: 24316715 DOI: 10.1038/nchembio.1432

Did we miss your publication?

Have you published using HPA038002? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-METTL14 (AMAb91275)
Anti-METTL14 (AMAb91276)
Corresponding Antigens
PrEST Antigen METTL14 (APrEST79779)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-METTL14