Enhanced Validation

Anti-MEF2C Antibody

myocyte enhancer factor 2C
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human MEF2C
Price
$445.00
Product Number
HPA005533
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
myocyte enhancer factor 2C
Target Gene
MEF2C
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000033134 (99%)

Mouse ENSMUSG00000005583 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
myocyte enhancer factor 2C
Gene Name
MEF2C
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000081189 on the Human Protein Atlas

Lockhart MM, Wirrig EE, Phelps AL, Ghatnekar AV, Barth JL, Norris RA, Wessels A

Mef2c Regulates Transcription of the Extracellular Matrix Protein Cartilage Link Protein 1 in the Developing Murine Heart

PLoS One , 2013; 8(2):e57073. Epub 2013 Feb 26

PubMed ID: 23468913 DOI: 10.1371/journal.pone.0057073

Clark CD, Zhang B, Lee B, Evans SI, Lassar AB, Lee KH

Evolutionary Conservation of Nkx2.5 Autoregulation in the Second Heart Field

Dev Biol , 2013 Feb 1; 374(1):198-209. Epub 2012 Nov 17

PubMed ID: 23165293 DOI: 10.1016/j.ydbio.2012.11.007

Wirrig EE, Hinton RB, Yutzey KE

Differential expression of cartilage and bone-related proteins in pediatric and adult diseased aortic valves

J Mol Cell Cardiol , 2011 Mar; 50(3):561-569. Epub 2010 Dec 14

PubMed ID: 21163264 DOI: 10.1016/j.yjmcc.2010.12.005

Yelamanchili SV, Chaudhuri AD, Chen LN, Xiong H, Fox HS

MicroRNA-21 dysregulates the expression of MEF2C in neurons in monkey and human SIV/HIV neurological disease

Cell Death Dis , 2010; 1(9):e77-. Epub 2010 Sep 23

PubMed ID: 21170291 DOI: 10.1038/cddis.2010.56

Did we miss your publication?

Have you published using HPA005533? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch