Enhanced Validation

Anti-MED12 Antibody

mediator complex subunit 12
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human MED12
Alternative Gene Names
CAGH45, FGS1, HOPA, KIAA0192, OKS, OPA1, TNRC11, TRAP230
Price
$450.00
Product Number
HPA003184
Unit Size
Concentration
Lot dependent
Availability
8 in Stock
Ships
Ready to Ship
Target Protein
mediator complex subunit 12
Target Gene
MED12
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RLLLYHTHLRPRPRAYYLEPLPLPPEDEEPPAPTLLEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKKRSQPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQ
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000003848 (94%)

Mouse ENSMUSG00000079487 (94%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-MED12 HPA003185.

Protein Name
mediator complex subunit 12
Gene Name
MED12
Alternative Gene Names
CAGH45, FGS1, HOPA, KIAA0192, OKS, OPA1, TNRC11, TRAP230
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000184634 on the Human Protein Atlas

Serna VA, Wu X, Qiang W, Thomas J, Blumenfeld ML, Kurita T

Cellular kinetics of MED12-mutant uterine leiomyoma growth and regression in vivo

Endocr Relat Cancer , 2018 Apr 26; 25(7):747-759. Epub 2018 Apr 26

PubMed ID: 29700012 DOI: 10.1530/ERC-18-0184

Wu X, Serna VA, Thomas J, Qiang W, Blumenfeld ML, Kurita T

Subtype-specific cancer-associated fibroblasts contribute to the pathogenesis of uterine leiomyoma

Cancer Res , 2017 Oct 20; 77(24):6891-6901. Epub 2017 Oct 20

PubMed ID: 29055020 DOI: 10.1158/0008-5472.CAN-17-1744

Pérot G, Croce S, Ribeiro A, Lagarde P, Velasco V, Neuville A, Coindre JM, Stoeckle E, Floquet A, MacGrogan G, Chibon F

MED12 Alterations in Both Human Benign and Malignant Uterine Soft Tissue Tumors

PLoS One , 2012; 7(6):e40015. Epub 2012 Jun 29

PubMed ID: 22768200 DOI: 10.1371/journal.pone.0040015

Did we miss your publication?

Have you published using HPA003184? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch