Anti-MCL1 Antibody

myeloid cell leukemia 1
Recommended Applications
Product Description
Polyclonal Antibody against Human MCL1
Alternative Gene Names
BCL2L3, Mcl-1
Price
$450.00
Product Number
HPA008455
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
myeloid cell leukemia 1
Target Gene
MCL1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000038612 (77%)

Rat ENSRNOG00000010237 (26%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
myeloid cell leukemia 1
Gene Name
MCL1
Alternative Gene Names
BCL2L3, Mcl-1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000143384 on the Human Protein Atlas

Carter RJ, Milani M, Butterworth M, Alotibi A, Harper N, Yedida G, Greaves G, Al-Zebeeby A, Jorgensen AL, Schache AG, Risk JM, Shaw RJ, Jones TM, Sacco JJ, Hurlstone A, Cohen GM, Varadarajan S

Exploring the potential of BH3 mimetic therapy in squamous cell carcinoma of the head and neck

Cell Death Dis , 2019 Dec 4; 10(12):912. Epub 2019 Dec 4

PubMed ID: 31801952 DOI: 10.1038/s41419-019-2150-8

Wu X, Luo Q, Zhao P, Chang W, Wang Y, Shu T, Ding F, Li B, Liu Z

JOSD1 inhibits mitochondrial apoptotic signalling to drive acquired chemoresistance in gynaecological cancer by stabilizing MCL1

Cell Death Differ , 2019 May 1; 27(1):55-70. Epub 2019 May 1

PubMed ID: 31043700 DOI: 10.1038/s41418-019-0339-0

Roders N, Herr F, Ambroise G, Thaunat O, Portier A, Vazquez A, Durrbach A

SYK Inhibition Induces Apoptosis in Germinal Center-Like B Cells by Modulating the Antiapoptotic Protein Myeloid Cell Leukemia-1, Affecting B-Cell Activation and Antibody Production

Front Immunol , 2018 Apr 24; 9:787. Epub 2018 Apr 24

PubMed ID: 29740433 DOI: 10.3389/fimmu.2018.00787

Márquez-Jurado S, Díaz-Colunga J, das Neves RP, Martinez-Lorente A, Almazán F, Guantes R, Iborra FJ

Mitochondrial levels determine variability in cell death by modulating apoptotic gene expression

Nat Commun , 2018 Jan 26; 9:389. Epub 2018 Jan 26

PubMed ID: 29374163 DOI: 10.1038/s41467-017-02787-4

Li Y, Buijs-Gladdines JG, Canté-Barrett K, Stubbs AP, Vroegindeweij EM, Smits WK, van Marion R, Dinjens WN, Horstmann M, Kuiper RP, Buijsman RC, Zaman GJ, van der Spek PJ, Pieters R, Meijerink JP

IL-7 Receptor Mutations and Steroid Resistance in Pediatric T cell Acute Lymphoblastic Leukemia: A Genome Sequencing Study

PLoS Med , 2016 Dec 20; 13(12):e1002200. Epub 2016 Dec 20

PubMed ID: 27997540 DOI: 10.1371/journal.pmed.1002200

Guantes R, Rastrojo A, Neves R, Lima A, Aguado B, Iborra FJ

Global variability in gene expression and alternative splicing is modulated by mitochondrial content

Genome Res , 2015 May; 25(5):633-644

PubMed ID: 25800673 DOI: 10.1101/gr.178426.114

Némati F, de Montrion C, Lang G, Kraus-Berthier L, Carita G, Sastre-Garau X, Berniard A, Vallerand D, Geneste O, de Plater L, Pierré A, Lockhart B, Desjardins L, Piperno-Neumann S, Depil S, Decaudin D

Targeting Bcl-2/Bcl-XL Induces Antitumor Activity in Uveal Melanoma Patient-Derived Xenografts

PLoS One , 2014; 9(1):e80836. Epub 2014 Jan 13

PubMed ID: 24454684 DOI: 10.1371/journal.pone.0080836

Ariës IM, Hansen BR, Koch T, van den Dungen R, Evans WE, Pieters R, den Boer ML

The synergism of MCL1 and glycolysis on pediatric acute lymphoblastic leukemia cell survival and prednisolone resistance

Haematologica , 2013 Dec; 98(12):1905-1911

PubMed ID: 24142999 DOI: 10.3324/haematol.2013.093823

Did we miss your publication?

Have you published using HPA008455? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch