Enhanced Validation

Polyclonal Anti-MAGEA8 Antibody

melanoma antigen family A, 8
References (2)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human MAGEA8
Alternative Gene Names
CT1.8, MAGE8, MGC2182
Open Datasheet
Price
$505.00
Product Number
HPA003998
Unit Size
Concentration
Lot dependent
Availability
2 in Stock
Ships
Ready to Ship
Show all images
[3 pictures]
Immunohistochemistry analysis in human placenta and prostate tissues using Anti-MAGEA8 antibody. Corresponding MAGEA8 RNA-seq data are presented for the same tissues.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
melanoma antigen family A, 8
Target Gene
MAGEA8
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000054784 (38%)

Mouse ENSMUSG00000079349 (35%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA003998 on the Human Protein Atlas
Protein Name
melanoma antigen family A, 8
Gene Name
MAGEA8
Alternative Gene Names
CT1.8, MAGE8, MGC2182
UniProt ID
P43361
Gene (Ensembl)
ENSG00000156009
Entrez Gene ID
Entrez gene: 4107
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000156009 on the Human Protein Atlas

Djureinovic D, Hallström BM, Horie M, Mattsson JS, La Fleur L, Fagerberg L, Brunnström H, Lindskog C, Madjar K, Rahnenführer J, Ekman S, Ståhle E, Koyi H, Brandén E, Edlund K, Hengstler JG, Lambe M, Saito A, Botling J, Pontén F, Uhlén M, Micke P

Profiling cancer testis antigens in non–small-cell lung cancer

JCI Insight , 2016 Jul 7; 1(10):e86837. Epub 2016 Jul 7

PubMed ID: 27699219 DOI: 10.1172/jci.insight.86837

Did we miss your publication?

Have you published using HPA003998? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen MAGEA8 (APrEST74539)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch