Enhanced Validation

Polyclonal Anti-LY6K Antibody

lymphocyte antigen 6 complex, locus K
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human LY6K
Alternative Gene Names
CT97, FLJ35226, HSJ001348
Price
$505.00
Product Number
HPA017770
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
lymphocyte antigen 6 complex, locus K
Target Gene
LY6K
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000044678 (41%)

Rat ENSRNOG00000025725 (39%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
lymphocyte antigen 6 complex, locus K
Gene Name
LY6K
Alternative Gene Names
CT97, FLJ35226, HSJ001348
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000160886 on the Human Protein Atlas

Benti S, Tiwari PB, Goodlett DW, Daneshian L, Kern GB, Smith MD, Uren A, Chruszcz M, Shimizu LS, Upadhyay G

Small Molecule Binds with Lymphocyte Antigen 6K to Induce Cancer Cell Death

Cancers (Basel) , 2020 Feb 22; 12(2):509. Epub 2020 Feb 22

PubMed ID: 32098321 DOI: 10.3390/cancers12020509

Carrero I, Liu HC, Sikora AG, Milosavljevic A

Histoepigenetic analysis of HPV- and tobacco-associated head and neck cancer identifies both subtype-specific and common therapeutic targets despite divergent microenvironments

Oncogene , 2019 Jan 17; 38(19):3551-3568. Epub 2019 Jan 17

PubMed ID: 30655605 DOI: 10.1038/s41388-018-0659-4

Ambatipudi S, Gerstung M, Pandey M, Samant T, Patil A, Kane S, Desai RS, Schäffer AA, Beerenwinkel N, Mahimkar MB

Genome-wide Expression and Copy Number Analysis Identifies Driver Genes in Gingivobuccal Cancers

Genes Chromosomes Cancer , 2012 Feb; 51(2):161-173. Epub 2011 Nov 10

PubMed ID: 22072328 DOI: 10.1002/gcc.20940

Johnson GR, Li J, Shariff A, Rohde GK, Murphy RF

Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules

PLoS Comput Biol , 1/01/01; 11(12):e1004614. Epub 2015 Dec 1

PubMed ID: 26624011 DOI: 10.1371/journal.pcbi.1004614

Did we miss your publication?

Have you published using HPA017770? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch