Enhanced Validation

Polyclonal Anti-LRG1 Antibody

leucine-rich alpha-2-glycoprotein 1
References (15)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human LRG1
Alternative Gene Names
LRG
Open Datasheet
Price
$505.00
Product Number
HPA001888
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human liver and cerebral cortex tissues using HPA001888 antibody. Corresponding LRG1 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in human plasma.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
leucine-rich alpha-2-glycoprotein 1
Target Gene
LRG1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000037095 (63%)

Rat ENSRNOG00000049918 (61%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA001888 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
leucine-rich alpha-2-glycoprotein 1
Gene Name
LRG1
Alternative Gene Names
LRG
UniProt ID
P02750
Gene (Ensembl)
ENSG00000171236
Entrez Gene ID
Entrez gene: 116844
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000171236 on the Human Protein Atlas

Choi CH, Barr W, Zaman S, Model C, Park A, Koenen M, Lin Z, Szwed SK, Marchildon F, Crane A, Carroll TS, Molina H, Cohen P

LRG1 is an adipokine that promotes insulin sensitivity and suppresses inflammation

eLife , 2022 Nov 8; 11:e81559. Epub 2022 Nov 8

PubMed ID: 36346018 DOI: 10.7554/eLife.81559

Yin GN, Kim DK, Kang JI, Im Y, Lee DS, Han AR, Ock J, Choi MJ, Kwon MH, Limanjaya A, Jung SB, Yang J, Min KW, Yun J, Koh Y, Park JE, Hwang D, Suh JK, Ryu JK, Kim HM

Latrophilin-2 is a novel receptor of LRG1 that rescues vascular and neurological abnormalities and restores diabetic erectile function

Exp Mol Med , 2022 May 13; 54(5):626-638. Epub 2022 May 13

PubMed ID: 35562586 DOI: 10.1038/s12276-022-00773-5

He Y, Tacconi C, Dieterich LC, Kim J, Restivo G, Gousopoulos E, Lindenblatt N, Levesque MP, Claassen M, Detmar M

Novel Blood Vascular Endothelial Subtype-Specific Markers in Human Skin Unearthed by Single-Cell Transcriptomic Profiling

Cells , 2022 Mar 25; 11(7):1111. Epub 2022 Mar 25

PubMed ID: 35406678 DOI: 10.3390/cells11071111

Mundo L, Tosi GM, Lazzi S, Pertile G, Parolini B, Neri G, Posarelli M, De Benedetto E, Bacci T, Silvestri E, Siciliano MC, Barbera S, Orlandini M, Greenwood J, Moss SE, Galvagni F

LRG1 Expression Is Elevated in the Eyes of Patients with Neovascular Age-Related Macular Degeneration

Int J Mol Sci , 2021 Aug 18; 22(16):8879. Epub 2021 Aug 18

PubMed ID: 34445590 DOI: 10.3390/ijms22168879

Kajimoto E, Endo M, Fujimoto M, Matsuzaki S, Fujii M, Yagi K, Kakigano A, Mimura K, Tomimatsu T, Serada S, Takeuchi M, Yoshino K, Ueda Y, Kimura T, Naka T

Evaluation of leucine-rich alpha-2 glycoprotein as a biomarker of fetal infection

PLoS One , 2020 Nov 19; 15(11):e0242076. Epub 2020 Nov 19

PubMed ID: 33211747 DOI: 10.1371/journal.pone.0242076

Fujimoto M, Matsumoto T, Serada S, Tsujimura Y, Hashimoto S, Yasutomi Y, Naka T

Leucine-rich alpha 2 glycoprotein is a new marker for active disease of tuberculosis

Sci Rep , 2020 Feb 25; 10:3384. Epub 2020 Feb 25

PubMed ID: 32099022 DOI: 10.1038/s41598-020-60450-3

Månberg A, Bradley F, Qundos U, Guthrie BL, Birse K, Noël-Romas L, Lindskog C, Bosire R, Kiarie J, Farquhar C, Burgener AD, Nilsson P, Broliden K

A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection

Mol Cell Proteomics , 2019 Mar; 18(3):461-476

PubMed ID: 30504243 DOI: 10.1074/mcp.RA118.000757

Zhang Q, Huang R, Tang Q, Yu Y, Huang Q, Chen Y, Wang G, Wang X

Leucine-rich alpha-2-glycoprotein-1 is up-regulated in colorectal cancer and is a tumor promoter

Onco Targets Ther , 2018 May 11; 11:2745-2752. Epub 2018 May 11

PubMed ID: 29785123 DOI: 10.2147/OTT.S153375

Yamamoto M, Takahashi T, Serada S, Sugase T, Tanaka K, Miyazaki Y, Makino T, Kurokawa Y, Yamasaki M, Nakajima K, Takiguchi S, Naka T, Mori M, Doki Y

Overexpression of leucine‐rich α2‐glycoprotein‐1 is a prognostic marker and enhances tumor migration in gastric cancer

Cancer Sci , 2017 Oct 2; 108(10):2052-2060. Epub 2017 Oct 2

PubMed ID: 28746773 DOI: 10.1111/cas.13329

Zhou Y, Zhang X, Zhang J, Fang J, Ge Z, Li X

LRG1 promotes proliferation and inhibits apoptosis in colorectal cancer cells via RUNX1 activation

PLoS One , 2017 Apr 4; 12(4):e0175122. Epub 2017 Apr 4

PubMed ID: 28376129 DOI: 10.1371/journal.pone.0175122

Honda H, Fujimoto M, Miyamoto S, Ishikawa N, Serada S, Hattori N, Nomura S, Kohno N, Yokoyama A, Naka T

Sputum Leucine-Rich Alpha-2 Glycoprotein as a Marker of Airway Inflammation in Asthma

PLoS One , 2016 Sep 9; 11(9):e0162672. Epub 2016 Sep 9

PubMed ID: 27611322 DOI: 10.1371/journal.pone.0162672

Lindén M, Segersten U, Runeson M, Wester K, Busch C, Pettersson U, Lind SB, Malmström PU

Tumour expression of bladder cancer-associated urinary proteins.

BJU Int , 2013 Aug; 112(3):407-15. Epub 2013 Mar 7

PubMed ID: 23470167 DOI: 10.1111/j.1464-410X.2012.11653.x

Xiaomeng Wang, Sabu Abraham, Jenny A. G. McKenzie, Natasha Jeffs, Matthew Swire, Vineeta B. Tripathi, Ulrich F. O. Luhmann, Clemens A. K. Lange, Zhenhua Zhai, Helen M. Arthur, James W. B. Bainbridge, Stephen E. Moss, John Greenwood

LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling

Nature , 499, 306-311 (2013)

PubMed ID: 0 DOI: 10.1038/nature12345

Wang X, Abraham S, McKenzie JA, Jeffs N, Swire M, Tripathi VB, Luhmann UF, Lange CA, Zhai Z, Arthur HM, Bainbridge J, Moss SE, Greenwood J

LRG1 promotes angiogenesis by modulating endothelial TGFß signalling

Nature , 2013 Jul 18; 499(7458):10.1038/nature12345

PubMed ID: 23868260 DOI: 10.1038/nature12345

Did we miss your publication?

Have you published using HPA001888? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-LRG1 (HPA001889)
Corresponding Antigens
PrEST Antigen LRG1 (APrEST84390)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch