Anti-LPAR2 Antibody

lysophosphatidic acid receptor 2
Recommended Applications
Product Description
Polyclonal Antibody against Human LPAR2
Alternative Gene Names
EDG-4, EDG4, LPA2
Price
$445.00
Product Number
HPA019616
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
lysophosphatidic acid receptor 2
Target Gene
LPAR2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000010758 (87%)

Mouse ENSMUSG00000031861 (85%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
Protein Name
lysophosphatidic acid receptor 2
Gene Name
LPAR2
Alternative Gene Names
EDG-4, EDG4, LPA2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000064547 on the Human Protein Atlas

Hashimoto S, Mikami S, Sugino H, Yoshikawa A, Hashimoto A, Onodera Y, Furukawa S, Handa H, Oikawa T, Okada Y, Oya M, Sabe H

Lysophosphatidic acid activates Arf6 to promote the mesenchymal malignancy of renal cancer

Nat Commun , 2016 Feb 8; 7:10656. Epub 2016 Feb 8

PubMed ID: 26854204 DOI: 10.1038/ncomms10656

Leve F, Peres-Moreira RJ, Binato R, Abdelhay E, Morgado-Díaz JA

LPA Induces Colon Cancer Cell Proliferation through a Cooperation between the ROCK and STAT-3 Pathways

PLoS One , 2015; 10(9):e0139094. Epub 2015 Sep 29

PubMed ID: 26418031 DOI: 10.1371/journal.pone.0139094

Kuriyama S, Theveneau E, Benedetto A, Parsons M, Tanaka M, Charras G, Kabla A, Mayor R

In vivo collective cell migration requires an LPAR2-dependent increase in tissue fluidity

J Cell Biol , 2014 Jul 7; 206(1):113-127

PubMed ID: 25002680 DOI: 10.1083/jcb.201402093

Did we miss your publication?

Have you published using HPA019616? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch