Polyclonal Anti-LEMD2 Antibody

LEM domain containing 2
References (10) Researcher contributions (1)
Recommended Applications
Product Description
Polyclonal Antibody against Human LEMD2
Alternative Gene Names
dJ482C21.1, NET25
Open Datasheet
Price
$459.00
Product Number
HPA017340
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human skin shows moderate to strong positivity in nuclear membrane in squamous epithelial cells.
Show all images
[1 pictures]
Western blot analysis in human cell line HeLa.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
LEM domain containing 2
Target Gene
LEMD2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAHP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000044857 (92%)

Rat ENSRNOG00000025864 (90%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA017340 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA017340 on the Human Protein Atlas
Protein Name
LEM domain containing 2
Gene Name
LEMD2
Alternative Gene Names
dJ482C21.1, NET25
UniProt ID
Q8NC56
Gene (Ensembl)
ENSG00000161904
Entrez Gene ID
Entrez gene: 221496
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000161904 on the Human Protein Atlas

Sears RM, Roux KJ

Mechanisms of A-Type Lamin Targeting to Nuclear Ruptures Are Disrupted in LMNA- and BANF1-Associated Progerias

Cells , 2022 Mar 2; 11(5):865. Epub 2022 Mar 2

PubMed ID: 35269487 DOI: 10.3390/cells11050865

Gatta AT, Olmos Y, Stoten CL, Chen Q, Rosenthal PB, Carlton JG

CDK1 controls CHMP7-dependent nuclear envelope reformation

eLife , 2021 Jul 21; 10:e59999. Epub 2021 Jul 21

PubMed ID: 34286694 DOI: 10.7554/eLife.59999

Ramirez-Martinez A, Zhang Y, Chen K, Kim J, Cenik BK, McAnally JR, Cai C, Shelton JM, Huang J, Brennan A, Evers BM, Mammen PP, Xu L, Bassel-Duby R, Liu N, Olson EN

The nuclear envelope protein Net39 is essential for muscle nuclear integrity and chromatin organization

Nat Commun , 2021 Jan 29; 12:690. Epub 2021 Jan 29

PubMed ID: 33514739 DOI: 10.1038/s41467-021-20987-x

Feurle P, Abentung A, Cera I, Wahl N, Ablinger C, Bucher M, Stefan E, Sprenger S, Teis D, Fischer A, Laighneach A, Whitton L, Morris DW, Apostolova G, Dechant G

SATB2‐LEMD2 interaction links nuclear shape plasticity to regulation of cognition‐related genes

EMBO J , 2020 Dec 15; 40(3):e103701. Epub 2020 Dec 15

PubMed ID: 33319920 DOI: 10.15252/embj.2019103701

Young AM, Gunn AL, Hatch EM

BAF facilitates interphase nuclear membrane repair through recruitment of nuclear transmembrane proteins

Mol Biol Cell , 2020 Jul 15; 31(15):1551-1560

PubMed ID: 32459568 DOI: 10.1091/mbc.E20-01-0009

von Appen A, LaJoie D, Johnson IE, Trnka MJ, Pick SM, Burlingame AL, Ullman KS, Frost A

LEM2 phase separation governs ESCRT-mediated nuclear envelope reformation

Nature , 2020 Apr 29; 582(7810):115-118. Epub 2020 Apr 29

PubMed ID: 32494070 DOI: 10.1038/s41586-020-2232-x

Suzuki Y, Bilir Ş, Hatano Y, Fukuda T, Mashiko D, Kobayashi S, Hiraoka Y, Haraguchi T, Yamagata K

Nuclear formation induced by DNA-conjugated beads in living fertilised mouse egg

Sci Rep , 2019 Jun 11; 9:8461. Epub 2019 Jun 11

PubMed ID: 31186495 DOI: 10.1038/s41598-019-44941-6

Halfmann CT, Sears RM, Katiyar A, Busselman BW, Aman LK, Zhang Q, O’Bryan CS, Angelini TE, Lele TP, Roux KJ

Repair of nuclear ruptures requires barrier-to-autointegration factor

J Cell Biol , 2019 May 30; 218(7):2136-2149. Epub 2019 May 30

PubMed ID: 31147383 DOI: 10.1083/jcb.201901116

Gu M, LaJoie D, Chen OS, von Appen A, Ladinsky MS, Redd MJ, Nikolova L, Bjorkman PJ, Sundquist WI, Ullman KS, Frost A

LEM2 recruits CHMP7 for ESCRT-mediated nuclear envelope closure in fission yeast and human cells

Proc Natl Acad Sci U S A , 2017 Feb 27; 114(11):E2166-E2175. Epub 2017 Feb 27

PubMed ID: 28242692 DOI: 10.1073/pnas.1613916114

Did we miss your publication?

Have you published using HPA017340? Please let us know and we will be happy to include your reference on this page.

Read more

User Data in Mouse, Explorer Program Submission

Contribution from Dr. Irina Solovei, University of Munich (LMU) — February 22, 2016

We have successfully tested the Anti-LEMD2 antibody (HPA017340) in mouse tissues, both cultured cells and cryosections, using immunofluorescence.

          A.                                                                                 B.                                                                                    C.

      lemd2-hpa017340-1lemd2-hpa017340-2 lemd2-hpa017340-3

Confocal images showing nuclear membranous positivity in mouse tissues (A and B) and cultured mouse myocytes (C) after staining with Anti-LEMD2 Antibody (HPA017340).

Antibody staining is shown in green. Secondary antibody was donkey-anti-rabbit conjugated to DyLight 488 (Jackson Immuno Research, 711-485-152); nuclei were counterstained with DAPI. The images are single optical sections acquired using Leica SP5 confocal microscope.

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen LEMD2 (APrEST71105)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch