Enhanced Validation

Polyclonal Anti-LAMC1 Antibody

laminin, gamma 1 (formerly LAMB2)
References (6)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human LAMC1
Alternative Gene Names
LAMB2
Open Datasheet
Price
$505.00
Product Number
HPA001909
Unit Size
Concentration
Lot dependent
Availability
6 in Stock
Ships
Ready to Ship
Show all images
[6 pictures]
Immunohistochemistry analysis in human placenta and tonsil tissues using HPA001909 antibody. Corresponding LAMC1 RNA-seq data are presented for the same tissues.
Show all images
[2 pictures]
Western blot analysis in human cell line CACO-2 and human cell line PC-3.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
laminin, gamma 1 (formerly LAMB2)
Target Gene
LAMC1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVS
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000002680 (89%)

Mouse ENSMUSG00000026478 (86%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-LAMC1 HPA001908.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA001909 on the Human Protein Atlas
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
laminin, gamma 1 (formerly LAMB2)
Gene Name
LAMC1
Alternative Gene Names
LAMB2
UniProt ID
P11047
Gene (Ensembl)
ENSG00000135862
Entrez Gene ID
Entrez gene: 3915
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000135862 on the Human Protein Atlas

Clotet-Freixas S, McEvoy CM, Batruch I, Pastrello C, Kotlyar M, Van JA, Arambewela M, Boshart A, Farkona S, Niu Y, Li Y, Famure O, Bozovic A, Kulasingam V, Chen P, Kim SJ, Chan E, Moshkelgosha S, Rahman SA, Das J, Martinu T, Juvet S, Jurisica I, Chruscinski A, John R, Konvalinka A

Extracellular Matrix Injury of Kidney Allografts in Antibody-Mediated Rejection: A Proteomics Study

J Am Soc Nephrol , 2020 Sep 8; 31(11):2705-2724. Epub 2020 Sep 8

PubMed ID: 32900843 DOI: 10.1681/ASN.2020030286

Chen LY, Huang RL, Chan MW, Yan PS, Huang TS, Wu RC, Rahmanto YS, Su PH, Weng YC, Chou JL, Chao TK, Wang YC, Shih IM, Lai HC

TET1 reprograms the epithelial ovarian cancer epigenome and reveals casein kinase 2α as a therapeutic target

J Pathol , 2019 Apr 23; 248(3):363-376. Epub 2019 Apr 23

PubMed ID: 30883733 DOI: 10.1002/path.5266

Visvanathan K, Shaw P, May BJ, Bahadirli-Talbott A, Kaushiva A, Risch H, Narod S, Wang TL, Parkash V, Vang R, Levine DA, Soslow R, Kurman R, Shih IM

Fallopian tube lesions in women at high risk for ovarian cancer: A multicenter study

Cancer Prev Res (Phila) , 2018 Sep 19; 11(11):697-706. Epub 2018 Sep 19

PubMed ID: 30232083 DOI: 10.1158/1940-6207.CAPR-18-0009

Arita T, Ichikawa D, Konishi H, Komatsu S, Shiozaki A, Ogino S, Fujita Y, Hiramoto H, Hamada J, Shoda K, Kosuga T, Fujiwara H, Okamoto K, Otsuji E

Tumor exosome-mediated promotion of adhesion to mesothelial cells in gastric cancer cells

Oncotarget , 2016 Jul 28; 7(35):56855-56863. Epub 2016 Jul 28

PubMed ID: 27487135 DOI: 10.18632/oncotarget.10869

Kuhn E, Kurman RJ, Soslow R, Han G, Sehdev AS, Morin PJ, Wang TL, Shih IM

The diagnostic and biological implications of laminin expression in serous tubal intraepithelial carcinoma

Am J Surg Pathol , 2012 Dec; 36(12):1826-1834

PubMed ID: 22892598 DOI: 10.1097/PAS.0b013e31825ec07a

Did we miss your publication?

Have you published using HPA001909? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch