Anti-LAMB3 Antibody

laminin, beta 3
Recommended Applications
Product Description
Polyclonal Antibody against Human LAMB3
Alternative Gene Names
BM600-125kDa, kalinin-140kDa, LAMNB1, nicein-125kDa
Price
$437.00
Product Number
HPA008069
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
laminin, beta 3
Target gene
LAMB3
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQ
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000006025 (76%)

Mouse ENSMUSG00000026639 (75%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
Protein Name
laminin, beta 3
Gene Name
LAMB3
Alternative Gene Names
BM600-125kDa, kalinin-140kDa, LAMNB1, nicein-125kDa
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000196878 on the Human Protein Atlas

Puram SV, Tirosh I, Parikh AS, Patel AP, Yizhak K, Gillespie S, Rodman C, Luo CL, Mroz EA, Emerick KS, Deschler DG, Varvares MA, Mylvaganam R, Rozenblatt-Rosen O, Rocco JW, Faquin WC, Lin DT, Regev A, Bernstein BE

Single-cell transcriptomic analysis of primary and metastatic tumor ecosystems in head and neck cancer

Cell , 2017 Nov 30; 171(7):1611-1624.e24. Epub 2017 Nov 30

PubMed ID: 29198524 DOI: 10.1016/j.cell.2017.10.044

YAMAMOTO N, KINOSHITA T, NOHATA N, ITESAKO T, YOSHINO H, ENOKIDA H, NAKAGAWA M, SHOZU M, SEKI N

Tumor suppressive microRNA-218 inhibits cancer cell migration and invasion by targeting focal adhesion pathways in cervical squamous cell carcinoma

Int J Oncol , 2013 May; 42(5):1523-1532. Epub 2013 Mar 7

PubMed ID: 23483249 DOI: 10.3892/ijo.2013.1851

Kinoshita T, Hanazawa T, Nohata N, Kikkawa N, Enokida H, Yoshino H, Yamasaki T, Hidaka H, Nakagawa M, Okamoto Y, Seki N

Tumor suppressive microRNA-218 inhibits cancer cell migration and invasion through targeting laminin-332 in head and neck squamous cell carcinoma

Oncotarget , 2012 Nov; 3(11):1386-1400. Epub 2012 Nov 7

PubMed ID: 23159910 DOI: 10.18632/oncotarget.709

Did we miss your publication?

Have you published using HPA008069? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch