Enhanced Validation

Polyclonal Anti-KRT19 Antibody

keratin 19
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human KRT19
Alternative Gene Names
CK19, K19, K1CS, MGC15366
Price
$459.00
Product Number
HPA002465
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
keratin 19
Target Gene
KRT19
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000020911 (79%)

Rat ENSRNOG00000003899 (74%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
keratin 19
Gene Name
KRT19
Alternative Gene Names
CK19, K19, K1CS, MGC15366
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000171345 on the Human Protein Atlas

Hassan S, Blick T, Wood J, Thompson EW, Williams ED

Circulating Tumour Cells Indicate the Presence of Residual Disease Post-Castration in Prostate Cancer Patient-Derived Xenograft Models

Front Cell Dev Biol , 2022 Apr 13; 10:858013. Epub 2022 Apr 13

PubMed ID: 35493092 DOI: 10.3389/fcell.2022.858013

Hassan S, Blick T, Thompson EW, Williams ED

Diversity of Epithelial-Mesenchymal Phenotypes in Circulating Tumour Cells from Prostate Cancer Patient-Derived Xenograft Models

Cancers (Basel) , 2021 Jun 1; 13(11):2750. Epub 2021 Jun 1

PubMed ID: 34206049 DOI: 10.3390/cancers13112750

Saranaruk P, Kariya R, Sittithumcharee G, Boueroy P, Boonmars T, Sawanyawisuth K, Wongkham C, Wongkham S, Okada S, Vaeteewoottacharn K

Chromomycin A3 suppresses cholangiocarcinoma growth by induction of S phase cell cycle arrest and suppression of Sp1-related anti-apoptotic proteins

Int J Mol Med , 2020 Jan 29; 45(4):1005-1016. Epub 2020 Jan 29

PubMed ID: 32124934 DOI: 10.3892/ijmm.2020.4482

Vaeteewoottacharn K, Pairojkul C, Kariya R, Muisuk K, Imtawil K, Chamgramol Y, Bhudhisawasdi V, Khuntikeo N, Pugkhem A, Saeseow OT, Silsirivanit A, Wongkham C, Wongkham S, Okada S

Establishment of Highly Transplantable Cholangiocarcinoma Cell Lines from a Patient-Derived Xenograft Mouse Model

Cells , 2019 May 23; 8(5):496. Epub 2019 May 23

PubMed ID: 31126020 DOI: 10.3390/cells8050496

Vaeteewoottacharn K, Kariya R, Pothipan P, Fujikawa S, Pairojkul C, Waraasawapati S, Kuwahara K, Wongkham C, Wongkham S, Okada S

Attenuation of CD47-SIRPα Signal in Cholangiocarcinoma Potentiates Tumor-Associated Macrophage-Mediated Phagocytosis and Suppresses Intrahepatic Metastasis

Transl Oncol , 2018 Nov 9; 12(2):217-225. Epub 2018 Nov 9

PubMed ID: 30415063 DOI: 10.1016/j.tranon.2018.10.007

Saentaweesuk W, Araki N, Vaeteewoottacharn K, Silsirivanit A, Seubwai W, Talabnin C, Muisuk K, Sripa B, Wongkham S, Okada S, Wongkham C

Activation of Vimentin Is Critical to Promote a Metastatic Potential of Cholangiocarcinoma Cells

Oncol Res , 2018 May 7; 26(4):605-616. Epub 2018 May 7

PubMed ID: 28762325 DOI: 10.3727/096504017X15009778205068

Scalia CR, Boi G, Bolognesi MM, Riva L, Manzoni M, DeSmedt L, Bosisio FM, Ronchi S, Leone BE, Cattoretti G

Antigen Masking During Fixation and Embedding, Dissected

J Histochem Cytochem , 2016 Oct 20; 65(1):5-20. Epub 2016 Oct 20

PubMed ID: 27798289 DOI: 10.1369/0022155416673995

Did we miss your publication?

Have you published using HPA002465? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch